DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and DIP-delta

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster

Alignment Length:487 Identity:122/488 (25%)
Similarity:196/488 (40%) Gaps:86/488 (18%)


  Fly    75 NRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLW----R 135
            :|.:|.|.|..:..:.:....:... |||..........||....|||.||:||.:.:.|    |
  Fly    19 SRFTNRRIMFLIYMTNLVTHVMMDE-PRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDR 82

  Fly   136 RGTNVLTASNIMVTRDERVRLI---DGYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPP 197
            :  .:||....:::|..|..:.   :.:.|.::.....|.|.|:||::......||..::::|||
  Fly    83 Q--MILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPP 145

  Fly   198 SVRAI-PTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSG-----ANKSTARIGDGPILTLEKL 256
            ::..| .|...:..|:...|.:.|:..|.|.|.|.|.::.|     ..|....:.|..:|.|.|:
  Fly   146 NILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKV 210

  Fly   257 ERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSW 321
            .|.:.|.|.|.|.|||...|:..:.|||.:.|.|.|....:.:..|.:..:.|...|.|.|.:.|
  Fly   211 SRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275

  Fly   322 YQNSFPI-----QSTDRRIMATRANRHM-LTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPG 380
            ..||..:     ..||....:.||  || ||||::|..|||||.|::.||||.:.         |
  Fly   276 VYNSVMVLPSKKYKTDYTENSYRA--HMKLTIRNLQYGDFGNYRCISKNSLGETE---------G 329

  Fly   381 AAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEP 445
            :...|......:|..                ::.:..|:..|....|...:|         .::.
  Fly   330 SIRVYEIPLPSTPSK----------------QVTHTTVESRENNIIPSSRND---------TTKS 369

  Fly   446 LTHIMSYTIKN-LHPGGYYEAIVQAKNRYGWNEVSDIFQFVVATNSQDIGPEDAEVVASSKSRSN 509
            |...:.|.:|| |:||.                         |::|...|...|  .:||.|...
  Fly   370 LQTDVGYAMKNDLYPGS-------------------------ASSSSSGGSSSA--ASSSSSMQT 407

  Fly   510 SASIGSLPGSTVLHTALLLALALSNCQFDRRR 541
            ||..|.:.|:::.......:||:....|...|
  Fly   408 SALPGGVAGNSLSSMGSKGSLAIGKSTFYTER 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 12/49 (24%)
IG_like 109..195 CDD:214653 23/93 (25%)
Ig 118..191 CDD:143165 21/80 (26%)
IG_like 205..274 CDD:214653 22/74 (30%)
IGc2 213..273 CDD:197706 21/65 (32%)
IGc2 301..367 CDD:197706 28/72 (39%)
FN3 392..486 CDD:238020 12/95 (13%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 23/94 (24%)
Ig 53..143 CDD:299845 23/92 (25%)
Ig 144..224 CDD:299845 23/80 (29%)
I-set 150..238 CDD:254352 27/88 (31%)
I-set 242..333 CDD:254352 33/102 (32%)
Ig 259..332 CDD:143165 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.