DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and CG34353

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster

Alignment Length:583 Identity:199/584 (34%)
Similarity:307/584 (53%) Gaps:100/584 (17%)


  Fly    32 KSSQRRNRAPLQMNCPILIVISLGWLLHAHAGS------GGFAVEAAISNRGSNSR-----SMSN 85
            :||...:|...:..|              |:.|      |..|.||...::..:.|     |:.:
  Fly     9 RSSSSSSRIAYKFEC--------------HSNSKQNSKTGKMAAEARTISKPGHIRDRRVGSLPH 59

  Fly    86 VQ-----------QSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTN 139
            :.           :|..|.|.:|...|.|:||..|::.:.|:|:||||:|.|...:|:.|:||..
  Fly    60 ILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKRGIA 124

  Fly   140 VLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPT 204
            :|||.::.||.|.||||::|:||:|.|..|.|||||:|||:....|:..|||||||||.:..|.|
  Fly   125 ILTAGSVKVTPDPRVRLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHIST 189

  Fly   205 SGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTAD 269
            .|.||.:||..:.:||..:|||:|::.|::|:....:........:|::|.::|.:.|||.|||:
  Fly   190 GGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTAN 254

  Fly   270 NGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRR 334
            |.||.|.:..:.|.||:.|:|.||:..:.||||.||.|||||..:....|.|::::..:.:|:|.
  Fly   255 NRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTERH 319

  Fly   335 IMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLT 399
            ||.||.:||.|.||.:..:|||||||||:|.||::||.::|||:|..|.|.||...:..|.||::
  Fly   320 IMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNIS 384

  Fly   400 WKIDSYPPLEEVRLLYRRV-------------------------QM------------------- 420
            |.:||:.|:||.:|.:|::                         ||                   
  Fly   385 WAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLSG 449

  Fly   421 ---NETYQQPGR--------WHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYG 474
               :.:|...|.        |.:.:|...  |.|......|||.::.|.|..:|||.||::||||
  Fly   450 LSGSGSYSGYGNVIHWGHNDWRNVVLPAV--PVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYG 512

  Fly   475 WNEVSDIFQFVVATNSQDIGPEDAEVVAS---SKSRSNSASIGSLPGSTVLHTALLLALALSN 534
            |:::::  .||.:|:|.| ||.|.....:   |.:.....|: :..||:.::...|..||||:
  Fly   513 WSDLTN--SFVFSTSSND-GPVDLSTFLNHGLSDNEMRDLSV-TFYGSSAINRQKLGLLALSS 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 22/83 (27%)
IG_like 109..195 CDD:214653 44/86 (51%)
Ig 118..191 CDD:143165 37/73 (51%)
IG_like 205..274 CDD:214653 25/69 (36%)
IGc2 213..273 CDD:197706 20/60 (33%)
IGc2 301..367 CDD:197706 33/66 (50%)
FN3 392..486 CDD:238020 36/149 (24%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 43/80 (54%)
Ig 103..177 CDD:143165 38/74 (51%)
IG_like 191..269 CDD:214653 27/78 (35%)
IGc2 198..258 CDD:197706 20/60 (33%)
I-set 273..360 CDD:254352 42/87 (48%)
Ig 290..359 CDD:143165 33/69 (48%)
FN3 <466..524 CDD:238020 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I3320
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D332048at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45080
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.