DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Ntm

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_008764287.1 Gene:Ntm RGDID:620958 Length:367 Species:Rattus norvegicus

Alignment Length:345 Identity:91/346 (26%)
Similarity:150/346 (43%) Gaps:66/346 (19%)


  Fly    42 LQMNCPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNS---RSMSNVQQSAVAASTLTATLPRF 103
            |...|  |:|:||..|         |.|...:..|..::   ::|.||                 
  Rat     9 LPWKC--LVVVSLRLL---------FLVPTGVPVRSGDATFPKAMDNV----------------- 45

  Fly   104 LSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDG----YNLEI 164
                 |.|.  |::..|.|.::|....| .|...:.:|.|.|.....|.||.|:..    |::||
  Rat    46 -----TVRQ--GESATLRCTIDNRVTRV-AWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEI 102

  Fly   165 SDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPS 229
            .:::..|.|.|.|.:... |..:...|.::|..|.:.:..|..:...:|..|:|.|..:|.|.|:
  Rat   103 QNVDVYDEGPYTCSVQTD-NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPT 166

  Fly   230 IYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEK 294
            :.|...|  .|:...:.:...|.::.:.|:|:|.|:|:|.|.|..||...:::.|.|||.|...|
  Rat   167 VTWRHIS--PKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAK 229

  Fly   295 SWIHSG--EGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATR-----ANR---HMLTIRH 349
            .   :|  .|.:..|.|...|.|.|...|:::       |:|::..:     .||   ..||..:
  Rat   230 G---TGVPVGQKGTLQCEASAVPSAEFQWFKD-------DKRLVEGKKGVKVENRPFLSRLTFFN 284

  Fly   350 IQQEDFGNYSCVADNSLGRS 369
            :.:.|:|||:|||.|.||.:
  Rat   285 VSEHDYGNYTCVASNKLGHT 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 11/64 (17%)
IG_like 109..195 CDD:214653 24/90 (27%)
Ig 118..191 CDD:143165 20/77 (26%)
IG_like 205..274 CDD:214653 20/69 (29%)
IGc2 213..273 CDD:197706 19/60 (32%)
IGc2 301..367 CDD:197706 22/74 (30%)
FN3 392..486 CDD:238020
NtmXP_008764287.1 Ig 44..132 CDD:299845 26/114 (23%)
IG_like 44..132 CDD:214653 26/114 (23%)
IG_like 142..219 CDD:214653 22/79 (28%)
IGc2 149..205 CDD:197706 17/58 (29%)
ig 226..308 CDD:278476 25/90 (28%)
IG_like 233..310 CDD:214653 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80477270
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.