DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and OPCML

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:292 Identity:65/292 - (22%)
Similarity:103/292 - (35%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NEEVQKLLALKEQLKQLTVDDDGSGETAAATPAPGKPAAASEPG-NRNLSLKTPKGTRDYGPEAM 96
            ::|..:|||::.||:.:|:          ..|.|.|   ..:|| :..||.|..      ||.|.
Human   232 HKEHLELLAVRIQLENVTL----------LNPEPVK---GPKPGPSVWLSWKVS------GPAAP 277

  Fly    97 ALRQRVLDQVVRVFRRHGAETIDTPVFELKEVLTG--KYGEDSKLIYDLK---------DQGGEI 150
            |.....|.:..|..|..|:...:..:..|:....|  .:|:|    |:.|         .....:
Human   278 AESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQD----YEFKVRPSSGRARGPDSNV 338

  Fly   151 LALRYDLTVPFARYVGM------GNVF-------------NIKRYHIAKVYRRDNPQITRGRYRE 196
            |.||....||.|...|:      |:||             .|:.|   :|:...|..:....:..
Human   339 LLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGY---QVWSLGNASLPAANWTV 400

  Fly   197 F-YQCDFDIAGTYDPMLPDAECVKVVCEILAEVGVGDFVVKLNHRKLLDGIFEACGVPADKFRTA 260
            . .|...:||    ..||.:.||:|.    |..|.|...:......||:...|.           
Human   401 VGEQTQLEIA----TRLPGSYCVQVA----AVTGAGAGELSTPVCLLLEQAMEQ----------- 446

  Fly   261 CSSVDKLDKTPW--EEVRREMVEEKGLSEEAV 290
             |:.|.....||  |::|..:...:.::..||
Human   447 -SARDPRKHVPWTLEQLRATLRRPEVIASSAV 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 22/115 (19%)
Ig strand B 118..122 CDD:409353 0/3 (0%)
Ig strand C 131..135 CDD:409353 1/5 (20%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 1/4 (25%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 16/74 (22%)
Ig_3 287..364 CDD:464046 2/4 (50%)
FN3 392..486 CDD:238020
OPCMLNP_001306032.1 Ig 44..132 CDD:472250
Ig strand B 53..57 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 98..102 CDD:409353
Ig strand F 112..117 CDD:409353
Ig strand G 125..128 CDD:409353
Ig_3 135..206 CDD:464046
Ig 224..312 CDD:472250 24/98 (24%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 2/3 (67%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 1/4 (25%)
Ig strand G 306..309 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.