DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Ama

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster

Alignment Length:290 Identity:87/291 (30%)
Similarity:136/291 (47%) Gaps:29/291 (10%)


  Fly   112 AVVGDTLVLPCQVENLGNFVLLWRR-----GTN--VLTASNIMVTRDER--VRLIDG-------Y 160
            |.|||::...|.||.:|...:.|.:     .||  ||:..||:...|:|  |.:.:|       |
  Fly    44 ASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIY 108

  Fly   161 NLEISDLEPQDAGDYVCQI----SDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECK 221
            ...|.::|..|.|.|.||:    ::|:.:..  :::|..|| |.|..|.......:|..:.|.|.
  Fly   109 TFRIQNIEVSDMGPYECQVLVSATEKVTKKL--SLQI
KTPP-VIAENTPKSTLVTEGQNLELTCH 170

  Fly   222 GSGNPVPSIYWTKKSGA-NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVL 285
            .:|.|.|:|.|.::..| ..:...:...|.|.:..:.|...|.|.|.|.||.|.|....:|::|.
  Fly   171 ANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVE 235

  Fly   286 YPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRAN-----RHML 345
            :.|.|.|::..|.......|:|.|.|...|..||.|::|..|:||:....:|..|:     ..:|
  Fly   236 FRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVL 300

  Fly   346 TIRHIQQEDFGNYSCVADNSLGRSRKYMEL 375
            .|..:.:||||:|.|.|.|.||.:...:.|
  Fly   301 RIDSVGEEDFGDYYCNATNKLGHADARLHL 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 5/12 (42%)
IG_like 109..195 CDD:214653 29/103 (28%)
Ig 118..191 CDD:143165 24/93 (26%)
IG_like 205..274 CDD:214653 19/70 (27%)
IGc2 213..273 CDD:197706 18/61 (30%)
IGc2 301..367 CDD:197706 25/71 (35%)
FN3 392..486 CDD:238020
AmaNP_731114.2 I-set 33..143 CDD:254352 28/101 (28%)
Ig 37..127 CDD:299845 27/83 (33%)
IG_like 154..234 CDD:214653 21/80 (26%)
IGc2 161..223 CDD:197706 18/62 (29%)
I-set 254..330 CDD:254352 26/76 (34%)
IGc2 254..322 CDD:197706 25/68 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80450475
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.