DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and CG7166

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster

Alignment Length:396 Identity:223/397 (56%)
Similarity:301/397 (76%) Gaps:6/397 (2%)


  Fly    99 TLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYNLE 163
            |.|:||||||.|:.:||:|:.|||:|:|||:||||||:|::||||.::.:|||:|.:::..|||:
  Fly    37 TAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQ 101

  Fly   164 ISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVP 228
            |:.::.||||||:||:.|:.||||||||||||||::||:|.:||:.||||..:|||||.||||||
  Fly   102 INGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVP 166

  Fly   229 SIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVE 293
            :|:|.||...:..| .:.|...|.||.::|..||.|||:|||||.|.|::|::|.:|.||:|.||
  Fly   167 TIFWFKKDVFSGPT-HLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVE 230

  Fly   294 KSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNY 358
            |||:|:.||::.:|||||..|..:.:.||||||.:.:||||.|..|.:|:.|.||:.|..|||||
  Fly   231 KSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNY 295

  Fly   359 SCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNET 423
            ||||||:|||::||:|:|||||.|:|.||......|.|||||.|:|.|||:|::|||||:.||||
  Fly   296 SCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIESIPPLDEIKLLYRRLLMNET 360

  Fly   424 YQQPGRWHDFILTPEHRPASEPLTH-IMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSDIFQFVVA 487
            ||.||:||::.:.|  .|.....:| :|||.:|||.....|||||||||:|||||:|||.||.  
  Fly   361 YQHPGKWHEYHIKP--TPIRTDGSHFLMSYLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFY-- 421

  Fly   488 TNSQDI 493
            |.:.|:
  Fly   422 TRNHDL 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 15/25 (60%)
IG_like 109..195 CDD:214653 50/86 (58%)
Ig 118..191 CDD:143165 42/73 (58%)
IG_like 205..274 CDD:214653 37/69 (54%)
IGc2 213..273 CDD:197706 32/60 (53%)
IGc2 301..367 CDD:197706 37/66 (56%)
FN3 392..486 CDD:238020 55/95 (58%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 49/83 (59%)
Ig 56..116 CDD:143165 33/60 (55%)
IG_like 144..221 CDD:214653 41/78 (53%)
IGc2 151..209 CDD:197706 31/59 (53%)
IG_like 232..313 CDD:214653 45/81 (56%)
Ig 242..311 CDD:143165 39/69 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I3320
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D332048at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45080
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.