DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and IGLON5

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 HGNCID:34550 Length:336 Species:Homo sapiens

Alignment Length:349 Identity:98/350 (28%)
Similarity:148/350 (42%) Gaps:59/350 (17%)


  Fly    57 LLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLP 121
            ||.|.|.:|     .|:.:||..|:|:                  .|.|....|....||...|.
Human    12 LLAAAALAG-----LAVISRGLLSQSL------------------EFNSPADNYTVCEGDNATLS 53

  Fly   122 CQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI----DGYNLEISDLEPQDAGDYVCQISDK 182
            |.::.....| .|...:|:|.|.|...|.|.||||:    :.:::.|:::...|.|.|.|...  
Human    54 CFIDEHVTRV-AWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQ-- 115

  Fly   183 INRDQVHTVEI--LVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARI 245
             .|.|.:|.::  :|....|.:..|..:...:||.:.|.|...|.|.|::.|.:......|    
Human   116 -TRHQPYTTQVYLIVHVPARIVNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTS---- 175

  Fly   246 GDGPILTLEKLERQQAGVYQCTADNGVGD-PVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVC 309
             :|.||.:..::|.|||.|:|...|||.. |.:..:.:.|.|||.| .:.:...:..|..|.|.|
Human   176 -EGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTI-TDVTSARTALGRAALLRC 238

  Fly   310 IVFADPVATVSWYQNSFPIQSTDRRIMA----------TRANRHMLTIRHIQQEDFGNYSCVADN 364
            ...|.|.|...||:        |.|:::          |...|.||...::....:|||:|.|.|
Human   239 EAMAVPPADFQWYK--------DDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAAN 295

  Fly   365 SLGRSRKYMELSGRPGAAEFYSPK 388
            .||.|...|.|. |||:.|..:|:
Human   296 RLGASSASMRLL-RPGSLENSAPR 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 13/61 (21%)
IG_like 109..195 CDD:214653 25/92 (27%)
Ig 118..191 CDD:143165 22/77 (29%)
IG_like 205..274 CDD:214653 22/69 (32%)
IGc2 213..273 CDD:197706 21/60 (35%)
IGc2 301..367 CDD:197706 22/76 (29%)
FN3 392..486 CDD:238020
IGLON5NP_001094842.1 Ig 41..129 CDD:325142 25/92 (27%)
Ig_3 134..199 CDD:316449 20/70 (29%)
Ig_3 217..295 CDD:316449 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80481127
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.