DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and CG13506

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster

Alignment Length:457 Identity:105/458 (23%)
Similarity:190/458 (41%) Gaps:76/458 (17%)


  Fly   115 GDTLVLPCQVEN--LGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVC 177
            ||.::|.|...|  |.|.|:.::....:....|.:   .:||:.:...::.:.::.|:|:.||.|
  Fly    84 GDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPI---SQRVQCMLNNSILLRNVSPEDSDDYYC 145

  Fly   178 QISDKINRDQVHT-------VEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKK 235
            :|..:  |.:.||       :.||...  |.|....| ..|:|....|||:.......:|.|:..
  Fly   146 E
ILPQ--RVRQHTALRVGARLSILCDD--RDITDRSQ-TFRQGDHHKLECRTYLPDNATIKWSFN 205

  Fly   236 SGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSG 300
            ....:.::......::.|:.::.:.||.|||.||:|...|....:.:||.|.|.:...:..:::.
  Fly   206 DLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTE 270

  Fly   301 EGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRA----NRHMLTIRHIQQEDFGNYSCV 361
            :|..|:|.|...|.|:....:.::...:|.:|:..:....    ||..|.:|.:...|.|.|.|.
  Fly   271 KGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQ 335

  Fly   362 ADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPD------SYNLTWKIDSYPPLEEVRLLYRRVQM 420
            .:|::|.:...:.:|        |:|:..:..|      ...|.|.:.|:..|.|..|.|   |:
  Fly   336 VENAIGSNEVKVHVS--------YNPETPQFEDMTVEGNKVTLHWLVRSHQLLSEAMLDY---QL 389

  Fly   421 NETYQQPGRWHDFILTPEHRPASE----PLTHIMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSDI 481
            ..:|    .|....:...||..:.    .:||.:..:      .|.:.|.|:.||..||:..|:.
  Fly   390 TGSY----TWSTVQVLETHRHNNTDNIWKITHQLELS------RGVWHARVKTKNTKGWSHFSND 444

  Fly   482 FQFVVATNSQDIGPEDAEVVASSK----------------SRSNSASIGSLPGSTVLHTALLLAL 530
            ..|.:        |||:||....:                |:..::|:..|....:|..||||.:
  Fly   445 HVFEI--------PEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVGVILLAALLLRV 501

  Fly   531 AL 532
            .|
  Fly   502 RL 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 4/9 (44%)
IG_like 109..195 CDD:214653 22/89 (25%)
Ig 118..191 CDD:143165 18/82 (22%)
IG_like 205..274 CDD:214653 17/69 (25%)
IGc2 213..273 CDD:197706 15/60 (25%)
IGc2 301..367 CDD:197706 17/70 (24%)
FN3 392..486 CDD:238020 24/104 (23%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/65 (25%)
IGc2 83..146 CDD:197706 16/65 (25%)
IG_like 176..254 CDD:214653 19/79 (24%)
Ig 176..239 CDD:299845 15/64 (23%)
I-set 258..349 CDD:254352 19/91 (21%)
Ig 275..348 CDD:143165 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141037147
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45080
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.