DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Fgfrl1

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_954545.1 Gene:Fgfrl1 RGDID:735156 Length:529 Species:Rattus norvegicus

Alignment Length:596 Identity:117/597 (20%)
Similarity:198/597 (33%) Gaps:207/597 (35%)


  Fly    47 PILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYR 111
            |.|:::.||.|..|.|..|             ..|....|             :||.::|     
  Rat     5 PALLLLLLGALPSAEAARG-------------PPRMADKV-------------VPRQVAR----- 38

  Fly   112 AVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYN--------LEISDLE 168
              :|.|:.|.|.||.....:.:|              |:|.|. :..|::        |::.::|
  Rat    39 --LGRTVRLQCPVEGDPPPLTMW--------------TKDGRT-IHSGWSRFRVLPQGLKVKEVE 86

  Fly   169 PQDAGDYVCQISDKINRDQVHTVEILV----PPSVRAIP--TSG-------QLQARK-------- 212
            .:|||.|||:.::......|:...|::    |......|  :||       |..||.        
  Rat    87 AEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKENPGPGGSSGGQEDPVSQQWARPRFTQPSKM 151

  Fly   213 ---------GGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGP------ILTLEKLERQQAG 262
                     |..:.|:|..||:|.|.|.|.|.   :::..|:....      .|:|:.|:.:.:|
  Rat   152 RRRVIARPVGSSVRLKCVASGHPRPDIMWMKD---DQTLTRLEASEHRKKKWTLSLKNLKPEDSG 213

  Fly   263 VYQCTADNGVGDPVTVDMRLDVL------------YPPDIQVEKSWIHSGEGFEAKLVCIVFADP 315
            .|.|...|..| .:....::||:            :|.:..|:       .|......|.|.:|.
  Rat   214 KYTCRVSNRAG-AINATYKVDVIQRTRSKPVLTGTHPVNTTVD-------FGGTTSFQCKVRSDV 270

  Fly   316 VATVSWYQNSFPIQSTDRRIMATRANRH-----------------------------MLTIRHIQ 351
            ...:.|.          :|:......||                             .|.|...:
  Rat   271 KPVIQWL----------KRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLISRAR 325

  Fly   352 QEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYR 416
            |:|.|.|.|:..|::|.|.:...|:..|.... ..|....|..:.:|.|.:....|...|.:|..
  Rat   326 QDDAGMYICLGANTMGYSFRSAFLTVLPDPKP-PGPPVAHSSSTTSLPWPVVIGIPAGAVFILGT 389

  Fly   417 -RVQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSD 480
             .:.:.:|.::|......:..|.|||                 ||       .::.|.|..::..
  Rat   390 VLLWLCQTKKKPCAPASTLPVPGHRP-----------------PG-------TSRERSGDKDLPS 430

  Fly   481 IF-------------QFVVATNSQDIGPE-------DAEVVASSKSRSNSASIGSLPGS------ 519
            :.             |.::|..| ..||:       |......:.:.:::.|.|....|      
  Rat   431 LAVGICEEHGSTMAPQHILAPGS-TAGPKLYPKLYTDVHTHTHTHTCTHTLSCGGQGSSAPACPL 494

  Fly   520 TVLHTALLLAL 530
            :||:||.|.||
  Rat   495 SVLNTANLQAL 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 10/61 (16%)
IG_like 109..195 CDD:214653 21/94 (22%)
Ig 118..191 CDD:143165 18/81 (22%)
IG_like 205..274 CDD:214653 24/99 (24%)
IGc2 213..273 CDD:197706 18/66 (27%)
IGc2 301..367 CDD:197706 16/95 (17%)
FN3 392..486 CDD:238020 17/108 (16%)
Fgfrl1NP_954545.1 I-set 29..112 CDD:254352 25/118 (21%)
IGc2 40..102 CDD:197706 19/77 (25%)
I-set 143..234 CDD:254352 20/95 (21%)
Ig2_FGFRL1-like 153..234 CDD:143264 20/85 (24%)
IG_like 249..351 CDD:214653 21/119 (18%)
Ig 257..352 CDD:299845 19/105 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5178
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.