DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and DIP-theta

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster

Alignment Length:565 Identity:137/566 (24%)
Similarity:232/566 (41%) Gaps:117/566 (21%)


  Fly    16 PITAHASANANASGLRKSS---QRRNRAPLQMNCPILI------VISL----------------- 54
            |:||.|:..|.....|:::   ||:...| :::..:::      |:|:                 
  Fly     7 PLTADAATIAARRQRRRAAGKLQRKREMP-EISSRLIVATATAAVVSIICLSLALPGCAAQESDD 70

  Fly    55 -GWLLH---AHAGSGGFAVEAA---------ISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSR 106
             |.|.|   .|.....|.:..:         ::...:....:.::::..|..:.....||:|...
  Fly    71 EGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAIPEKDLPKFGEL 135

  Fly   107 GHTYRAVVGDTLVLPCQVENLGNFVLLWRR--GTNVLTASNIMVTRDERVRLID----GYNLEIS 165
            .......|....||.|.|:||..:.:.|.|  ...:||..|.::|::.|:.:..    .:.|.|.
  Fly   136 LQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIR 200

  Fly   166 DLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSI 230
            |::..|.|.|:|||:....:.||..::::|||.:...|||..:..|:|..:||:|..:|:|.|:|
  Fly   201 DVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTI 265

  Fly   231 YWTKKSG-----ANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDI 290
            .|.::.|     .|.:.|...:|..||:.|:.|...|.|.|.|.||:...|:..:.|.|.:||.|
  Fly   266 TWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMI 330

  Fly   291 QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIR----HIQ 351
            .::...:.:.......|.|...|.|.:...|.:|...|...:|.:..|..:.:.:|:|    .:.
  Fly   331 WIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVD 395

  Fly   352 QEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYR 416
            .:|||.|.|||.||||.:         .||.:.|......:..:...|..|::.|.:        
  Fly   396 IQDFGAYRCVAKNSLGDT---------DGAIKLYHIPQTTTMTTMAPTVSINTVPVV-------- 443

  Fly   417 RVQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYE--AIVQAKNR------- 472
            .|:.|:               |.|..|...::...|   |.:||...:  .:.:.|:.       
  Fly   444 LVKYNK---------------EQRYGSSQNSNTNPY---NFNPGNSQQNTKLQRGKSNSKGSDQS 490

  Fly   473 -YGWNEVSDIFQFVVAT----NSQDIGPEDAEVVASSKSRSNSAS 512
             .|.|.|     ||.||    ||||        ..||.|.|:|||
  Fly   491 PSGLNNV-----FVGATSSLWNSQD--------HHSSSSSSSSAS 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 9/70 (13%)
IG_like 109..195 CDD:214653 25/92 (27%)
Ig 118..191 CDD:143165 24/79 (30%)
IG_like 205..274 CDD:214653 25/74 (34%)
IGc2 213..273 CDD:197706 23/65 (35%)
IGc2 301..367 CDD:197706 21/70 (30%)
FN3 392..486 CDD:238020 18/104 (17%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 25/93 (27%)
IG_like 137..230 CDD:214653 25/93 (27%)
IG_like 240..324 CDD:214653 27/84 (32%)
IGc2 247..310 CDD:197706 21/63 (33%)
Ig 327..419 CDD:299845 27/101 (27%)
IG_like 343..420 CDD:214653 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.