DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and DIP-kappa

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster

Alignment Length:388 Identity:103/389 (26%)
Similarity:170/389 (44%) Gaps:65/389 (17%)


  Fly    31 RKSSQRRNRAPLQMN-----CPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSA 90
            |..::||.|...:.|     ..|:...::..|:.|      ....|.|.::|.::|  .:.||:|
  Fly    11 RPHTRRRFRLQAEFNVRQLAITIIATAAVTMLMTA------TPTLAEIPSKGKHTR--LDTQQTA 67

  Fly    91 VAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRR--GTNVLTASNIMVTRDER 153
            ...|    ..|||..........||...::.|.||||..:.:.|.|  ...:|:..:.:::::.|
  Fly    68 QEDS----DFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSR 128

  Fly   154 VRLIDGYN------LEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARK 212
            :.|.  ||      |.|.::|..|.|.|:||::....|.:...::::|||.:....||..:..|:
  Fly   129 ISLT--YNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVRE 191

  Fly   213 GGPITLECKGSGNPVPSIYWTKKSGANK----STARIGDGPILTLEKLERQQAGVYQCTADNGVG 273
            |..|:|.||..|.|.|.:.|.::.|...    ....:.||.:|.:.|:.|.....|.|.|.|||.
  Fly   192 GQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVP 256

  Fly   274 DPVTVDMRLDVLYPPDI----QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRR 334
            ..::..:.|.|.:||.:    |:|.:::    |.:..|.|...|.|.:...|        :|:|.
  Fly   257 PSISKRVHLRVQFPPMLSIPNQLEGAYL----GQDVILECHTEAYPASINYW--------TTERG 309

  Fly   335 IM----ATRA-------------NRHM-LTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRP 379
            .|    .:||             .::| |.||.:...|||.|.|||.||||.:...::|...|
  Fly   310 DMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMP 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 14/61 (23%)
IG_like 109..195 CDD:214653 23/94 (24%)
Ig 118..191 CDD:143165 21/81 (26%)
IG_like 205..274 CDD:214653 23/73 (32%)
IGc2 213..273 CDD:197706 21/64 (33%)
IGc2 301..367 CDD:197706 25/84 (30%)
FN3 392..486 CDD:238020
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 23/94 (24%)
IG_like 82..174 CDD:214653 23/94 (24%)
IG_like 184..267 CDD:214653 24/83 (29%)
IGc2 191..255 CDD:197706 20/64 (31%)
IG_like 282..368 CDD:214653 26/98 (27%)
Ig 288..367 CDD:143165 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80481845
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.