DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and DIP-alpha

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster

Alignment Length:397 Identity:98/398 (25%)
Similarity:173/398 (43%) Gaps:63/398 (16%)


  Fly   101 PRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLW-RRGTNVLTA--SNIMVTRDERVRLI----D 158
            |.|:.........||......|.|.:||.:.:.| :..|..:.|  .|: :|.:.||.:.    :
  Fly    42 PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENV-ITHNPRVTVSHLDQN 105

  Fly   159 GYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGS 223
            .:||.|..:..:|.|.|:||::....:.|:..:::::||...:..||..:...:|..:.|.|:..
  Fly   106 TWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRAR 170

  Fly   224 GNPVPSIYWTKKSG---------ANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVD 279
            |.|.|.:.|.::.|         ..|:.|....|.:|.|.|:.|.:.|.|.|.|.|||...|:..
  Fly   171 GYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKR 235

  Fly   280 MRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNS---------FPIQSTDRRI 335
            :.|.:.:.|.|||....:.:..|.:.::.|.|.|.|.:...|.:::         :.:|.:.:.:
  Fly   236 ISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSM 300

  Fly   336 MATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSP-----KWGRSPDS 395
            ..|:.:   :.:|..|::|.|:|.|:|.||||.....:.|...||.....:|     |.|.:..|
  Fly   301 YETKMS---MIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGS 362

  Fly   396 YNLTWKIDSYPPLEEVRLLYRRVQMNETYQ------QPGRWHDFI--------LTP-----EHRP 441
                  :|:    :...:|.::.|:..|||      |.|...||.        |||     .:..
  Fly   363 ------LDA----DANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGGEGGGLTPLSPHVYYTS 417

  Fly   442 ASEPLTH 448
            .::|.||
  Fly   418 GNKPATH 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 5/23 (22%)
IG_like 109..195 CDD:214653 22/93 (24%)
Ig 118..191 CDD:143165 20/80 (25%)
IG_like 205..274 CDD:214653 23/78 (29%)
IGc2 213..273 CDD:197706 22/69 (32%)
IGc2 301..367 CDD:197706 18/75 (24%)
FN3 392..486 CDD:238020 17/77 (22%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/81 (26%)
Ig 51..131 CDD:299845 21/81 (26%)
I-set 144..240 CDD:254352 27/96 (28%)
IGc2 159..228 CDD:197706 21/69 (30%)
Ig 244..337 CDD:299845 23/96 (24%)
I-set 244..337 CDD:254352 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.