Sequence 1: | NP_524454.2 | Gene: | klg / 42707 | FlyBaseID: | FBgn0017590 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
Alignment Length: | 337 | Identity: | 90/337 - (26%) |
---|---|---|---|
Similarity: | 143/337 - (42%) | Gaps: | 57/337 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 NRAPLQMN-CPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLP 101
Fly 102 RFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLID----GYNL 162
Fly 163 EISDLEPQDAGDYVC--QISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGN 225
Fly 226 PVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDI 290
Fly 291 QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDF 355
Fly 356 GNYSCVADNSLG 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klg | NP_524454.2 | DUF1370 | 63..>124 | CDD:284518 | 12/60 (20%) |
IG_like | 109..195 | CDD:214653 | 24/91 (26%) | ||
Ig | 118..191 | CDD:143165 | 21/78 (27%) | ||
IG_like | 205..274 | CDD:214653 | 20/68 (29%) | ||
IGc2 | 213..273 | CDD:197706 | 18/59 (31%) | ||
IGc2 | 301..367 | CDD:197706 | 20/65 (31%) | ||
FN3 | 392..486 | CDD:238020 | |||
Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 26/120 (22%) |
FR1 | 55..71 | CDD:409353 | 6/44 (14%) | ||
Ig strand A' | 56..62 | CDD:409353 | 1/8 (13%) | ||
Ig strand B | 64..72 | CDD:409353 | 4/7 (57%) | ||
CDR1 | 72..76 | CDD:409353 | 2/4 (50%) | ||
FR2 | 77..84 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 77..83 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 85..95 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 87..90 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 92..95 | CDD:409353 | 0/2 (0%) | ||
FR3 | 96..131 | CDD:409353 | 11/34 (32%) | ||
Ig strand D | 100..107 | CDD:409353 | 3/6 (50%) | ||
Ig strand E | 110..116 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 132..136 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 136..145 | CDD:409353 | 2/9 (22%) | ||
FR4 | 138..145 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 148..218 | CDD:404760 | 21/73 (29%) | ||
Ig strand A' | 155..160 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 166..173 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 179..184 | CDD:409353 | 2/4 (50%) | ||
Ig strand D | 190..193 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 197..203 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 210..217 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 224..232 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 235..311 | CDD:404760 | 24/76 (32%) | ||
Ig strand B | 252..256 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 290..294 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 304..309 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 318..321 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166337168 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.740 |