DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Lsamp

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:337 Identity:90/337 - (26%)
Similarity:143/337 - (42%) Gaps:57/337 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NRAPLQMN-CPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLP 101
            |:.|.::| .||.|              .|..|.:...|||:::   ..|:|             
  Rat    28 NQPPAEVNLSPITI--------------PGLPVRSVDFNRGTDN---ITVRQ------------- 62

  Fly   102 RFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLID----GYNL 162
                         |||.:|.|.||: .|..:.|...:.::.|.:...:.|.||.|..    .|:|
  Rat    63 -------------GDTAILRCVVED-KNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSL 113

  Fly   163 EISDLEPQDAGDYVC--QISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGN 225
            .|..::..|.|.|.|  |...:....||:.: :.|||.:..|  |..:...:|..:||.|..:|.
  Rat   114 RIQKVDVYDEGSYTCSVQTQHEPKTSQVYLI-VQVPPKISNI--SSDVTVNEGSNVTLVCMANGR 175

  Fly   226 PVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDI 290
            |.|.|.|...:...:...  |:...|.:..:.|:|:|.|:|.|.|.|.......:::.|.|||.|
  Rat   176 PEPVITWRHLTPLGREFE--GEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTI 238

  Fly   291 QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDF 355
            ...|| ..:..|.:|.|.|...|.|.....||::...|.|.:...:.:...:..||:.::.:|.:
  Rat   239 TESKS-NEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHY 302

  Fly   356 GNYSCVADNSLG 367
            |||:|||.|.||
  Rat   303 GNYTCVAANKLG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 12/60 (20%)
IG_like 109..195 CDD:214653 24/91 (26%)
Ig 118..191 CDD:143165 21/78 (27%)
IG_like 205..274 CDD:214653 20/68 (29%)
IGc2 213..273 CDD:197706 18/59 (31%)
IGc2 301..367 CDD:197706 20/65 (31%)
FN3 392..486 CDD:238020
LsampXP_038944182.1 Ig 55..145 CDD:416386 26/120 (22%)
FR1 55..71 CDD:409353 6/44 (14%)
Ig strand A' 56..62 CDD:409353 1/8 (13%)
Ig strand B 64..72 CDD:409353 4/7 (57%)
CDR1 72..76 CDD:409353 2/4 (50%)
FR2 77..84 CDD:409353 1/6 (17%)
Ig strand C 77..83 CDD:409353 1/5 (20%)
CDR2 85..95 CDD:409353 1/9 (11%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 11/34 (32%)
Ig strand D 100..107 CDD:409353 3/6 (50%)
Ig strand E 110..116 CDD:409353 2/5 (40%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 0/3 (0%)
Ig strand G 136..145 CDD:409353 2/9 (22%)
FR4 138..145 CDD:409353 2/7 (29%)
Ig_3 148..218 CDD:404760 21/73 (29%)
Ig strand A' 155..160 CDD:409353 1/4 (25%)
Ig strand B 166..173 CDD:409353 3/6 (50%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 1/5 (20%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 0/7 (0%)
Ig_3 235..311 CDD:404760 24/76 (32%)
Ig strand B 252..256 CDD:409353 2/3 (67%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 1/3 (33%)
Ig strand F 304..309 CDD:409353 3/4 (75%)
Ig strand G 318..321 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337168
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.