DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Lsamp

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_006248401.1 Gene:Lsamp RGDID:71102 Length:361 Species:Rattus norvegicus

Alignment Length:325 Identity:88/326 (27%)
Similarity:141/326 (43%) Gaps:47/326 (14%)


  Fly    49 LIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAV 113
            |:::.|..||..     |..|.:...|||:::   ..|:|                         
  Rat    14 LVLLRLLCLLPT-----GLPVRSVDFNRGTDN---ITVRQ------------------------- 45

  Fly   114 VGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLID----GYNLEISDLEPQDAGD 174
             |||.:|.|.||: .|..:.|...:.::.|.:...:.|.||.|..    .|:|.|..::..|.|.
  Rat    46 -GDTAILRCVVED-KNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGS 108

  Fly   175 YVC--QISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSG 237
            |.|  |...:....||:.: :.|||.:..|  |..:...:|..:||.|..:|.|.|.|.|...:.
  Rat   109 YTCSVQTQHEPKTSQVYLI-VQVPPKISNI--SSDVTVNEGSNVTLVCMANGRPEPVITWRHLTP 170

  Fly   238 ANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEG 302
            ..:...  |:...|.:..:.|:|:|.|:|.|.|.|.......:::.|.|||.|...|| ..:..|
  Rat   171 LGREFE--GEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKS-NEATTG 232

  Fly   303 FEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLG 367
            .:|.|.|...|.|.....||::...|.|.:...:.:...:..||:.::.:|.:|||:|||.|.||
  Rat   233 RQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLG 297

  Fly   368  367
              Rat   298  297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 12/61 (20%)
IG_like 109..195 CDD:214653 24/92 (26%)
Ig 118..191 CDD:143165 21/79 (27%)
IG_like 205..274 CDD:214653 20/69 (29%)
IGc2 213..273 CDD:197706 19/60 (32%)
IGc2 301..367 CDD:197706 21/66 (32%)
FN3 392..486 CDD:238020
LsampXP_006248401.1 Ig 38..128 CDD:299845 26/121 (21%)
IG_like 40..128 CDD:214653 26/119 (22%)
I-set 132..215 CDD:254352 22/87 (25%)
IGc2 145..204 CDD:197706 19/61 (31%)
I-set 218..305 CDD:254352 27/82 (33%)
IGc2 232..297 CDD:197706 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80485996
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.