DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and DIP-lambda

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster

Alignment Length:482 Identity:114/483 (24%)
Similarity:194/483 (40%) Gaps:133/483 (28%)


  Fly   101 PRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTN--VLTASNIMVTRDERVRLI-DGYN- 161
            |:||::.......:|..:...|.|:|||::.:.|.:..:  :|.....||:.:.|:.:. :|:| 
  Fly    50 PQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNT 114

  Fly   162 --LEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSV----RAIPTSGQLQARKGGPITLEC 220
              |.||.::..|:|.|:||::....:.....::::|||.:    ...|..|..|  :||.|:|.|
  Fly   115 WKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQ--EGGSISLMC 177

  Fly   221 KGSGNPVPSIYWTKKS---------GANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPV 276
            ..:|.|.|.:.|.:::         |.:|:..:..:|..|.|..::|...|.|.|.|.||:  |.
  Fly   178 SVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGI--PP 240

  Fly   277 TVDMRLDVL--YPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQ----------NSFPIQ 329
            :|..|.:|.  :.|.::.....:.:....|..|.|||...|.....||:          |.:.|.
  Fly   241 SVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNIS 305

  Fly   330 STDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPD 394
            .....|.....|   |||||:.:.|||.|||.:.|:||:|                         
  Fly   306 EEVINIYTWHLN---LTIRHLTKSDFGTYSCSSVNALGKS------------------------- 342

  Fly   395 SYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIKN--L 457
                    :|...|:|:||             |.:     ||      :.|..| |..|.|:  .
  Fly   343 --------ESLIRLQELRL-------------PPK-----LT------TTPTPH-MQTTGKSRRK 374

  Fly   458 HPGGYYEAI--------------VQAKNRYGWNEVSDIFQFVVATNSQD-------------IGP 495
            ||..:.:.:              :|.:|. ..||..|:.:|   |||::             |..
  Fly   375 HPASHKKGLNEVLRFQETHFANQIQQENE-DHNEGFDLLKF---TNSENSNIVLESGHINSMINK 435

  Fly   496 EDAEVV---ASSKSRSNSASIGSLPGS 519
            ||..:.   ...:.::|..| |::|.:
  Fly   436 EDVNIYHPKQYGQEKTNKPS-GTIPST 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 5/23 (22%)
IG_like 109..195 CDD:214653 21/92 (23%)
Ig 118..191 CDD:143165 20/79 (25%)
IG_like 205..274 CDD:214653 23/78 (29%)
IGc2 213..273 CDD:197706 21/69 (30%)
IGc2 301..367 CDD:197706 25/76 (33%)
FN3 392..486 CDD:238020 21/110 (19%)
DIP-lambdaNP_001334747.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.