DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and NEGR1

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 HGNCID:17302 Length:354 Species:Homo sapiens

Alignment Length:330 Identity:96/331 (29%)
Similarity:150/331 (45%) Gaps:33/331 (10%)


  Fly    84 SNVQQSAVAASTLTATLPRFLSRGHT----YRAV------VGDTLVLPCQVENLGNFVLLWRRGT 138
            ||...:||..| |...||..|..|.:    :.||      .|||.||.|.:|: |.....|...:
Human    13 SNQWLAAVLLS-LCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRS 75

  Fly   139 NVLTASNIMVTRDERVRLID----GYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPP 197
            :::.|.....:.|.||.:..    .|:|:|.:::..|.|.|.|.:..:  ....||| :.:.|||
Human    76 SIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPP 139

  Fly   198 SVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAG 262
            .:..|  |..:...:|..:||.|..:|.|.|||.|...|.:.|.   ..:|..|.:..:.|.|||
Human   140 KIYDI--SNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKP---FENGQYLDIYGITRDQAG 199

  Fly   263 VYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFP 327
            .|:|:|:|.|..|....:::.|.:.|.||..||...: .|....:.|.....|.....||:....
Human   200 EYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVT-PGRSGLIRCEGAGVPPPAFEWYKGEKK 263

  Fly   328 IQSTDRRIMATR-ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS-------GRPGAAEF 384
            :.:..:.|:... :.|.:||:.::.||.||||:|||.|.||.:...:.|:       |..|:|:.
Human   264 LFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADV 328

  Fly   385 YSPKW 389
            ....|
Human   329 LFSCW 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 18/50 (36%)
IG_like 109..195 CDD:214653 25/102 (25%)
Ig 118..191 CDD:143165 20/79 (25%)
IG_like 205..274 CDD:214653 24/69 (35%)
IGc2 213..273 CDD:197706 23/60 (38%)
IGc2 301..367 CDD:197706 20/67 (30%)
FN3 392..486 CDD:238020
NEGR1NP_776169.2 Ig 44..135 CDD:299845 25/93 (27%)
IG_like 47..135 CDD:214653 23/90 (26%)
IGc2 152..210 CDD:197706 23/61 (38%)
IG_like 231..312 CDD:214653 23/82 (28%)
Ig 243..309 CDD:143165 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80490980
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.