DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Ntm

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm MGIID:2446259 Length:367 Species:Mus musculus

Alignment Length:286 Identity:81/287 (28%)
Similarity:135/287 (47%) Gaps:31/287 (11%)


  Fly    98 ATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDG--- 159
            ||.|:.:. ..|.|.  |::..|.|.::|....| .|...:.:|.|.|.....|.||.|:..   
Mouse    36 ATFPKAMD-NVTVRQ--GESATLRCTIDNRVTRV-AWLNRSTILYAGNDKWCLDPRVVLLSNTQT 96

  Fly   160 -YNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGS 223
             |::||.:::..|.|.|.|.:... |..:...|.::|..|.:.:..|..:...:|..|:|.|..:
Mouse    97 QYSIEIQNVDVYDEGPYTCSVQTD-NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIAT 160

  Fly   224 GNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPP 288
            |.|.|::.|...|  .|:...:.:...|.::.:.|:|:|.|:|:|.|.|..||...:::.|.|||
Mouse   161 GRPEPTVTWRHIS--PKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPP 223

  Fly   289 DIQVEKSWIHSG--EGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATR-----ANR---H 343
            .|...|.   :|  .|.:..|.|...|.|.|...|:::       |:|::..:     .||   .
Mouse   224 YISEAKG---TGVPVGQKGTLQCEASAVPSAEFQWFKD-------DKRLVEGKKGVKVENRPFLS 278

  Fly   344 MLTIRHIQQEDFGNYSCVADNSLGRS 369
            .||..::.:.|:|||:|||.|.||.:
Mouse   279 KLTFFNVSEHDYGNYTCVASNKLGHT 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 8/26 (31%)
IG_like 109..195 CDD:214653 24/90 (27%)
Ig 118..191 CDD:143165 20/77 (26%)
IG_like 205..274 CDD:214653 20/69 (29%)
IGc2 213..273 CDD:197706 19/60 (32%)
IGc2 301..367 CDD:197706 22/74 (30%)
FN3 392..486 CDD:238020
NtmNP_001344522.1 Ig 44..132 CDD:325142 24/92 (26%)
Ig_3 136..205 CDD:316449 18/71 (25%)
IG 233..310 CDD:214652 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80477027
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.