DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and wrk-1

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001024651.1 Gene:wrk-1 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans

Alignment Length:475 Identity:121/476 (25%)
Similarity:201/476 (42%) Gaps:77/476 (16%)


  Fly    96 LTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGY 160
            :.:|..:..::|.|..|..|::|.|.|:||: .:..::||:.|.|:...      ||.:....||
 Worm    13 IASTSAQIRTKGGTLIAKEGESLTLRCEVED-PSVAIIWRKNTEVVAVD------DEILDTYGGY 70

  Fly   161 N---------LEISDLEPQDAGDYVCQISD-KINRDQVHTVEILVP------PSVRAIPTSGQLQ 209
            .         |.|..:||.::.:|.|.::: :::...|..|::..|      |.|...|.:|...
 Worm    71 EISMEGSTSVLTIKRVEPINSANYSCALAEPEVSVTFVIKVQVFKPTQVSVKPLVVISPDTGVYH 135

  Fly   210 ARKGGP---ITLECKGSGNPVPSIYWTKKSG-ANKSTARIGDGPILTLEKLERQQAGVYQCTADN 270
            ||.|..   ||...| .|||.|.:.|||::. ..:...|...|..:.:.::::..||.|.|.|:|
 Worm   136 ARVGEKNLVITCHVK-EGNPKPGVVWTKQAAKLPEDIKREHGGARIVITEVKKHHAGKYNCLAEN 199

  Fly   271 GVG-DPVTVDMRLDVLYP-PDIQVEKSWIHSGEGF-------EAKLVCIVFADPVATVSWYQNSF 326
            ..| |..|:|  :.|..| ...:.||.|:.:.:.|       .|...|.....||..|.|..|.:
 Worm   200 IAGSDRATID--IHVAEPLQGEREEKPWVKNEDTFIPVRKNQNASFWCTYDGTPVPQVEWLFNGY 262

  Fly   327 PIQSTDRRIMAT-----RAN---RHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAE 383
            .|...|.:...|     |.|   :..||:..|.:|.||:|:|...|.||.....:.:|||||..:
 Worm   263 KINFNDEKFKKTSETAQRLNGYSKSTLTVGDISEEAFGDYACRISNKLGSVTAVVHVSGRPGPPQ 327

  Fly   384 FYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEPLTH 448
            .       |.|...|||.:.::..:.|.:|.:|  ..|..:..|...:...:........:..||
 Worm   328 L-------SFDESELTWTVRAFDKILEYQLCHR--LENADHFLPEDCNSVRVKKSDNNGDDKWTH 383

  Fly   449 IMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSDIFQFVVATNSQDIGPEDA---EVVASSKSRSNS 510
            .:..: ..|..|..|...::|:|..||..::                :||   |:....|..:..
 Worm   384 TIDLS-TFLEHGNKYHVQLKARNALGWGSMA----------------KDALHVELQRIEKEEAKG 431

  Fly   511 ASIGSLPGSTVLHTALLLAL 530
            |||.|:. |::|.|.:.:.|
 Worm   432 ASIISII-SSILVTLVTMYL 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 8/28 (29%)
IG_like 109..195 CDD:214653 24/96 (25%)
Ig 118..191 CDD:143165 20/83 (24%)
IG_like 205..274 CDD:214653 23/74 (31%)
IGc2 213..273 CDD:197706 19/64 (30%)
IGc2 301..367 CDD:197706 23/81 (28%)
FN3 392..486 CDD:238020 19/94 (20%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 24/95 (25%)
IGc2 31..96 CDD:197706 19/72 (26%)
IG_like 132..212 CDD:214653 26/83 (31%)
IGc2 142..202 CDD:197706 18/61 (30%)
IG_like 235..320 CDD:214653 23/85 (27%)
Ig 245..318 CDD:143165 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 1 1.000 H106843
Inparanoid 1 1.050 118 1.000 Inparanoid score I3320
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D332048at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T375303
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45080
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17012
TreeFam 1 0.960
1111.060

Return to query results.
Submit another query.