DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Fgfrl1

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 MGIID:2150920 Length:529 Species:Mus musculus

Alignment Length:601 Identity:118/602 (20%)
Similarity:195/602 (32%) Gaps:217/602 (36%)


  Fly    47 PILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYR 111
            |.|:::.||.|..|.|..|             ..|....|             :||.::|     
Mouse     5 PALLLLLLGALPSAEAARG-------------PPRMADKV-------------VPRQVAR----- 38

  Fly   112 AVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYN--------LEISDLE 168
              :|.|:.|.|.||.....:.:|              |:|.|. :..|::        |::.::|
Mouse    39 --LGRTVRLQCPVEGDPPPLTMW--------------TKDGRT-IHSGWSRFRVLPQGLKVKEVE 86

  Fly   169 PQDAGDYVCQISDKINRDQVHTVEIL---VPPSVRAIPTSG----------QLQARK-------- 212
            .:|||.|||:.::......|:...|:   :.|...:....|          |..||.        
Mouse    87 AEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQPSKM 151

  Fly   213 ---------GGPITLECKGSGNPVPSIYWTK-----------KSGANKSTARIGDGPILTLEKLE 257
                     |..:.|:|..||:|.|.|.|.|           :....|.|        |:|:.|:
Mouse   152 RRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWT--------LSLKNLK 208

  Fly   258 RQQAGVYQCTADNGVGDPVTVDMRLDVL------------YPPDIQVEKSWIHSGEGFEAKLVCI 310
            .:.:|.|.|...|..| .:....::||:            :|.:..|:       .|......|.
Mouse   209 PEDSGKYTCRVSNKAG-AINATYKVDVIQRTRSKPVLTGTHPVNTTVD-------FGGTTSFQCK 265

  Fly   311 VFADPVATVSWYQNSFPIQSTDRRIMATRANRH-----------------------------MLT 346
            |.:|....:.|.          :|:......||                             .|.
Mouse   266 VRSDVKPVIQWL----------KRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL 320

  Fly   347 IRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEV 411
            |...:|:|.|.|.|:..|::|.|.:...|:..|.... ..|....|..|.:|.|.:....|...|
Mouse   321 ISRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKP-PGPPMASSSSSTSLPWPVVIGIPAGAV 384

  Fly   412 RLLYR-RVQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYGW 475
            .:|.. .:.:.:|.::|......:..|.|||                 ||       .::.|.|.
Mouse   385 FILGTVLLWLCQTKKKPCAPASTLPVPGHRP-----------------PG-------TSRERSGD 425

  Fly   476 NEVSDIF-------------QFVVATNSQDIGPE-------DAEVVASSKSRSNSASIGSLPGST 520
            .::..:.             |.::|:.| ..||:       |......:.:.:::.|.|....||
Mouse   426 KDLPSLAVGICEEHGSAMAPQHILASGS-TAGPKLYPKLYTDVHTHTHTHTCTHTLSCGGQGSST 489

  Fly   521 ------VLHTALLLAL 530
                  ||:||.|.||
Mouse   490 PACPLSVLNTANLQAL 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 10/61 (16%)
IG_like 109..195 CDD:214653 21/97 (22%)
Ig 118..191 CDD:143165 18/81 (22%)
IG_like 205..274 CDD:214653 24/107 (22%)
IGc2 213..273 CDD:197706 19/71 (27%)
IGc2 301..367 CDD:197706 16/95 (17%)
FN3 392..486 CDD:238020 18/108 (17%)
Fgfrl1NP_473412.1 I-set 29..112 CDD:254352 25/118 (21%)
IGc2 40..102 CDD:197706 19/77 (25%)
I-set 143..234 CDD:254352 21/100 (21%)
Ig2_FGFRL1-like 153..234 CDD:143264 21/90 (23%)
IG_like 249..351 CDD:214653 21/119 (18%)
Ig 257..352 CDD:299845 19/105 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5329
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.