DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Opcml

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml RGDID:620635 Length:354 Species:Rattus norvegicus

Alignment Length:353 Identity:86/354 (24%)
Similarity:148/354 (42%) Gaps:69/354 (19%)


  Fly    42 LQMNCPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNS---RSMSNVQQSAVAASTLTATLPRF 103
            |...|  |:|:||..|         |.|...:..|..::   ::|.||......::||..|:...
  Rat     9 LPWKC--LVVVSLRLL---------FLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDR 62

  Fly   104 LSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI----DGYNLEI 164
            ::|                         :.|...:.:|.|.|...:.|.||.::    ..|::.|
  Rat    63 VTR-------------------------VAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMI 102

  Fly   165 SDLEPQDAGDYVC--QISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPV 227
            .:::..|.|.|.|  |..:.....:||.: :.|||.:..|  |..:...:|..:||.|...|.|.
  Rat   103 QNVDVYDEGPYTCSVQTDNHPKTSRVHLI-VQVPPQIMNI--SSDITVNEGSSVTLLCLAIGRPE 164

  Fly   228 PSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQV 292
            |::.|...| ..:....:.:...|.:..::|.|:|.|:|:|.|.|..|....:::.|.|||.|..
  Rat   165 PTVTWRHLS-VKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISK 228

  Fly   293 EKSWIHSG--EGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRI--------MATRANRHMLTI 347
            .|   ::|  .|.:..|.|...|.|:|...|::.       |.|:        :..:.....||.
  Rat   229 AK---NTGVSVGQKGILSCEASAVPMAEFQWFKE-------DTRLATGLDGVRIENKGRISTLTF 283

  Fly   348 RHIQQEDFGNYSCVADNSLGRSRKYMEL 375
            .::.::|:|||:|||.|.||.:...:.|
  Rat   284 FNVSEKDYGNYTCVATNKLGNTNASITL 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 10/64 (16%)
IG_like 109..195 CDD:214653 16/92 (17%)
Ig 118..191 CDD:143165 16/79 (20%)
IG_like 205..274 CDD:214653 19/69 (28%)
IGc2 213..273 CDD:197706 18/60 (30%)
IGc2 301..367 CDD:197706 20/74 (27%)
FN3 392..486 CDD:238020
OpcmlXP_017450901.1 Ig 44..132 CDD:353325 22/114 (19%)
Ig_3 135..206 CDD:339005 20/74 (27%)
IG_like 234..312 CDD:214653 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80495476
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.