DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and ntm

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis

Alignment Length:262 Identity:76/263 (29%)
Similarity:127/263 (48%) Gaps:14/263 (5%)


  Fly   115 GDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI----DGYNLEISDLEPQDAGDY 175
            ||:.:|.|.|:|....| .|...:.:|...|...:.|.||.|:    ..|::||.:::..|.|.|
 Frog    51 GDSAILRCTVDNRVTRV-AWLNRSTILYTGNDKWSIDPRVVLLANTKSQYSIEIQNVDIYDEGPY 114

  Fly   176 VC--QISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGA 238
            .|  |..:.....:||.: :.|||  |.:..|..:...:|..::|.|..:|.|.|.:.|...|  
 Frog   115 TCSVQTDNHPKTSRVHLI-V
QVPP--RIVDISSSIAVNEGSNVSLICIANGRPEPVVNWRYLS-- 174

  Fly   239 NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGF 303
            .|:...:.:...|.:..:.|:|:|:|:|:|.|.|..|....::|.|.|||.| ::...|.:..|.
 Frog   175 PKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTV
NYPPYI-LDAQNIGAPLGH 238

  Fly   304 EAKLVCIVFADPVATVSWYQNSFPIQSTDRRI-MATRANRHMLTIRHIQQEDFGNYSCVADNSLG 367
            ...|.|...|.|.|...||:....:..:.|.: :..|.....:|..::.::|:|||:|:|.|.||
 Frog   239 RGILQCEASAVPAADFFWYKEDKRLSDSWRGVKVENRETISRVTFLNVSEQDYGNYTCMAKNLLG 303

  Fly   368 RS 369
            .|
 Frog   304 HS 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 4/9 (44%)
IG_like 109..195 CDD:214653 24/86 (28%)
Ig 118..191 CDD:143165 22/79 (28%)
IG_like 205..274 CDD:214653 19/69 (28%)
IGc2 213..273 CDD:197706 18/60 (30%)
IGc2 301..367 CDD:197706 19/67 (28%)
FN3 392..486 CDD:238020
ntmXP_004916061.1 Ig 45..133 CDD:299845 24/84 (29%)
IG_like 45..133 CDD:214653 24/84 (29%)
IG_like 143..220 CDD:214653 21/79 (27%)
IGc2 150..209 CDD:197706 18/61 (30%)
ig 227..311 CDD:278476 22/80 (28%)
IG_like 230..311 CDD:214653 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80476869
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.