| Sequence 1: | NP_524454.2 | Gene: | klg / 42707 | FlyBaseID: | FBgn0017590 | Length: | 545 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 311 | Identity: | 89/311 - (28%) |
|---|---|---|---|
| Similarity: | 141/311 - (45%) | Gaps: | 28/311 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 SNVQQSAVAASTLTATLPRFLSRGHT----YRAV------VGDTLVLPCQVENLGNFVLLWRRGT 138
Fly 139 NVLTASNIMVTRDERVRLIDG----YNLEISDLEPQDAGDYVCQISDKINRD--QVHTVEILVPP 197
Fly 198 SVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAG 262
Fly 263 VYQCTADNGVGDPVTVDMRLDVLYPPDI-QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSF 326
Fly 327 PIQSTDRRIMATRAN-RHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS 376 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| klg | NP_524454.2 | DUF1370 | 63..>124 | CDD:284518 | 16/49 (33%) |
| IG_like | 109..195 | CDD:214653 | 23/101 (23%) | ||
| Ig | 118..191 | CDD:143165 | 19/78 (24%) | ||
| IG_like | 205..274 | CDD:214653 | 24/68 (35%) | ||
| IGc2 | 213..273 | CDD:197706 | 22/59 (37%) | ||
| IGc2 | 301..367 | CDD:197706 | 20/66 (30%) | ||
| FN3 | 392..486 | CDD:238020 | |||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 23/93 (25%) |
| FR1 | 44..62 | CDD:409353 | 5/17 (29%) | ||
| Ig strand A' | 47..53 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 55..63 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 63..68 | CDD:409353 | 2/5 (40%) | ||
| FR2 | 69..75 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 69..74 | CDD:409353 | 1/4 (25%) | ||
| CDR2 | 76..87 | CDD:409353 | 1/10 (10%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..122 | CDD:409353 | 10/33 (30%) | ||
| Ig strand D | 91..98 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 101..107 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 123..127 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 127..136 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 129..136 | CDD:409353 | 3/7 (43%) | ||
| Ig_3 | 140..208 | CDD:404760 | 24/72 (33%) | ||
| Ig strand A' | 146..151 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 157..164 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 170..175 | CDD:409353 | 3/4 (75%) | ||
| Ig strand C' | 177..179 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 187..193 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 200..207 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 214..222 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 226..302 | CDD:404760 | 22/77 (29%) | ||
| putative Ig strand A | 226..232 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 242..246 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 295..300 | CDD:409353 | 3/4 (75%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.000 | |||||