DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and negr1

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001106537.1 Gene:negr1 XenbaseID:XB-GENE-987949 Length:369 Species:Xenopus tropicalis

Alignment Length:342 Identity:95/343 (28%)
Similarity:152/343 (44%) Gaps:35/343 (10%)


  Fly    84 SNVQQSAVAASTLTATLPRFLSRGHT----YRAV------VGDTLVLPCQVENLGNFVLLWRRGT 138
            ||...:||..| |...||..|..|.:    :.||      .|:|.:|.|.:|. |.....|...:
 Frog    14 SNQWLAAVILS-LCCLLPSCLPAGQSMDFQWPAVDNLVVRQGETAMLRCFLEE-GASKGAWLNRS 76

  Fly   139 NVLTASNIMVTRDERVRLIDG----YNLEISDLEPQDAGDYVCQISDKINRD--QVHTVEILVPP 197
            :::.|.....:.|.||.:...    |:|.|..::..|.|.|.|.:..:.:..  ||| :.:.|.|
 Frog    77 SIIFAGGDKWSVDPRVSIATSSKQEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQVH-LTVHVSP 140

  Fly   198 SVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAG 262
            .:..|  |..:...:|..::|.|..:|.|.|||.|...|   .|..:.|.|..|.:..:.|.|||
 Frog   141 KIYDI--SSDMTVNEGTNVSLICLATGKPEPSISWRHIS---PSAKQFGSGQYLDIYGITRDQAG 200

  Fly   263 VYQCTADNGVGDPVTVDMRLDVLYPPDI-QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSF 326
            .|:|:|:|.|..|....:::.|.:.|.| ::..:.:..|.  ...:.|...|.|.....||:...
 Frog   201 DYECSAENDVSFPDVKKVKVTVNFAPTILEITPTGVSLGR--TGLIRCETAAVPAPVFEWYKGEK 263

  Fly   327 PIQSTDRRIMATRAN-RHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSG--RPGAAEFYSPK 388
            .:.:..|.|.....| |.:||:.::.:|.||||:|||.|.||.|...:.|:.  .|...   ||.
 Frog   264 KLTNGQRGIRIQNYNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTT---SPV 325

  Fly   389 WGRSPDS--YNLTWKID 403
            ...:|.:  |.:|.:.:
 Frog   326 TSSAPSTAQYGITGRAE 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 16/50 (32%)
IG_like 109..195 CDD:214653 23/102 (23%)
Ig 118..191 CDD:143165 19/79 (24%)
IG_like 205..274 CDD:214653 24/69 (35%)
IGc2 213..273 CDD:197706 23/60 (38%)
IGc2 301..367 CDD:197706 21/67 (31%)
FN3 392..486 CDD:238020 3/15 (20%)
negr1NP_001106537.1 Ig 44..136 CDD:325142 23/94 (24%)
Ig_3 140..208 CDD:316449 24/73 (33%)
IG_like 236..313 CDD:214653 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80490612
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.