DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and lsamp

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001096385.1 Gene:lsamp XenbaseID:XB-GENE-5759171 Length:334 Species:Xenopus tropicalis

Alignment Length:274 Identity:84/275 (31%)
Similarity:129/275 (47%) Gaps:17/275 (6%)


  Fly   115 GDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRL----IDGYNLEISDLEPQDAGDY 175
            |||.:|.|.||:..:.| .|...:.::.|.:...:.|.||.|    :..|:|.|..::..|.|.|
 Frog    43 GDTAILRCFVEDRSSRV-AWLNRSGIIFAGDDKWSLDPRVELEKRSLLEYSLRIQKVDVSDEGPY 106

  Fly   176 VCQISDK--INRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGA 238
            .|.:..|  ....||:.: :.|||.:..|  |..:...:|..:||.|...|.|.|.|.|...:  
 Frog   107 TCSVQTKQHTKTTQVYLI-V
QVPPKISNI--SADITVNEGSNVTLMCIAYGRPEPMITWRHLT-- 166

  Fly   239 NKSTAR--IGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGE 301
              .|||  .|:...|.::.:.|:|:|.|:|.|.|.|.......:|:.|.|||.|...|| ..:..
 Frog   167 --PTARDFEGEEEFLEIQGITREQSGRYECKAANEVASADVKQVRVTV
NYPPIITESKS-NEATT 228

  Fly   302 GFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSL 366
            |.:|.|.|...|.|.....||::...|.|.....:....:|.:|.:.::.:|.:|||:|||.|.|
 Frog   229 GKQAILRCEASAVPAPDFEWYKDDTRINSAQGLEIRNTGSRSVLMVANVTEEHYGNYTCVAANKL 293

  Fly   367 GRSRKYMELSGRPG 380
            |.:...:.|...||
 Frog   294 GITNTSLYLYIGPG 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 5/9 (56%)
IG_like 109..195 CDD:214653 24/86 (28%)
Ig 118..191 CDD:143165 21/79 (27%)
IG_like 205..274 CDD:214653 23/71 (32%)
IGc2 213..273 CDD:197706 22/62 (35%)
IGc2 301..367 CDD:197706 21/66 (32%)
FN3 392..486 CDD:238020
lsampNP_001096385.1 Ig 35..125 CDD:299845 24/84 (29%)
IG_like 37..125 CDD:214653 24/84 (29%)
Ig 128..212 CDD:299845 27/90 (30%)
I-set 129..212 CDD:254352 26/89 (29%)
IG_like 221..304 CDD:214653 25/84 (30%)
IGc2 229..294 CDD:197706 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80485549
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.