DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and Rnf220

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_006503348.1 Gene:Rnf220 MGIID:1913993 Length:592 Species:Mus musculus

Alignment Length:408 Identity:143/409 (35%)
Similarity:200/409 (49%) Gaps:72/409 (18%)


  Fly    25 ICPTCDVKIKRSQVADHCQVEMERLHN-PIS-------AVTPPTPTS------------GATASE 69
            :||.|.|.::.|::.:|.:.|:|:|.. |.|       |:.|.||.|            ..|||.
Mouse   223 LCPICQVLLRPSELQEHMEQELEQLAQLPASKNSLLKDAMAPGTPKSLLLSASIKREGDSPTASP 287

  Fly    70 ESGSVSG--GRQPWSVFQRVQRNRQARQRQRTRKRPASPAPPATVNPTVAAAPPPAAATPSVAAA 132
            .|.:...  ....:..|.||:.|||.|...|..|..........|                    
Mouse   288 HSSATEDLHHSDRYQTFLRVRANRQTRLNARIGKMKRRKQDEGQV-------------------- 332

  Fly   133 ESSQPTCPVCNHNF--PQSNIQEHVNHCLRQSRRNGQANGERHSSE-DSEDSEEYEEYEWAGQKR 194
                  ||:|:...  .:..:..||.|||  ::|.|....|..:.: :..||..:|||||.||||
Mouse   333 ------CPLCSRPLAGSEQEMSRHVEHCL--AKREGSCMAEDDAVDIEHADSNRFEEYEWCGQKR 389

  Fly   195 IRVSTLVQGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGDVIPLVNEDTE 259
            ||.:||::||:...|.   :..:|.:  ..|.|.||:||.|||..||..||.|.||||...|:. 
Mouse   390 IRATTLLEGGFRGSGF---VMCSGKE--NPDSDADLDVDGDDTLEYGKPQYTEADVIPCTGEEP- 448

  Fly   260 GNVSEADVTSYVRRLISSSDGPK----PNHSSEATEQEPASTSNVEAPPASEEPSTSRST---RS 317
               .||.....:|..:.:...|.    |..|..|:::.| ||||.|.........|.:::   :.
Mouse   449 ---GEAKEREALRGAVLNGGPPSTRITPEFSKWASDEMP-STSNGEGSKQEAMQKTCKNSDIEKI 509

  Fly   318 TSQNQQQIIESLKAKLRLYEKQ-AQG-KYKCLICIDDYKNPAISVSCWHVHCEQCWLQTLGARKL 380
            |.::.....|:|||::|..|:| ::| :||||||:|.|..|..|:.|||||||:|||:||||:||
Mouse   510 TEESAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKL 574

  Fly   381 CPQCNSITTPKDLRRIYL 398
            |||||:||.|.|||||||
Mouse   575 CPQCNTITAPGDLRRIYL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 82/281 (29%)
zf-C3HC4_2 346..384 CDD:290634 27/38 (71%)
Rnf220XP_006503348.1 RNF220 217..468 CDD:292548 83/282 (29%)
zf-C3HC4_2 540..578 CDD:290634 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146031438
eggNOG 1 0.900 E1_28IQH
Hieranoid 1 1.000
Homologene 1 1.000 H10036
Inparanoid 1 1.050 195 1.000 Inparanoid score I3804
Isobase 1 0.950 0 Normalized mean entropy S6937
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004755
OrthoInspector 1 1.000 T1083944
orthoMCL 1 0.900 OOG5_133932
Panther 1 1.100 LDO PTHR13459
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5368
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.