DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and rnf220a

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_021336297.1 Gene:rnf220a ZFINID:ZDB-GENE-060929-1006 Length:695 Species:Danio rerio

Alignment Length:482 Identity:151/483 (31%)
Similarity:210/483 (43%) Gaps:124/483 (26%)


  Fly    25 ICPTCDVKIKRSQVADHCQVEMERL-HNPISA--------VTPPTPTS------------GATAS 68
            |||.|.|.::..::.:|.:.||||| |..||.        |.|.||.|            ....|
Zfish   230 ICPICQVLLRPGELQEHMEQEMERLTHMHISKNPSHKDINVAPGTPKSLLLSVHIKREGESPVVS 294

  Fly    69 EESGSVSGGRQPWSVFQRVQRNRQARQRQ------RTRKRPASPAPPATVNPTVAAAPPPAAATP 127
            ..|...:.....:..|.||:.|||.|...      |...:.:..:||..| |......|......
Zfish   295 PLSSDEAHHSDRYQTFLRVRANRQTRLNVDDLCWCRRYAKESFKSPPIPV-PRGVPLAPCCLRHA 358

  Fly   128 SVAAAESSQP----TCPVCNHNFPQSNIQE----HVNHCLRQSRRNGQANGERHSSEDSEDSEEY 184
            .:...:..:|    .||:|  :.|.:..:|    ||..||  .:|.| |..|..:..:.|:...:
Zfish   359 RIGKMKRRKPEDGQVCPLC--SAPLAGTEEEMSRHVEQCL--FKREG-ATEEDSADVEGENGTRF 418

  Fly   185 EEYEWAGQKRIRVSTLVQGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGD 249
            |||||.||||:|.:||::||:...|...     .|.:...|.|.||:||.|||..||..||.|.|
Zfish   419 EEYEWCGQKRVRATTLLEGGFRGTGFAM-----CSTKESHDSDADLDVDGDDTLEYGKAQYTEAD 478

  Fly   250 VIPLVNEDTEGNVSEADVTSYVRRLISSSDGPK----PNHSSEATEQEPASTSNVEAPPASEEPS 310
            :||...|| :|...|.:.   :|..:.:...|.    |..|..|:::.| ||||.|:.......|
Zfish   479 IIPCSGED-QGEAKEREA---LRGAVLNGGVPSNRITPEFSKWASDEMP-STSNGESSKQEPSSS 538

  Fly   311 TSRSTRSTSQNQQ----------QIIESLKAKLRLYEKQ-AQG-KYKCLICI------------- 350
            :|.||:.|.:|.:          ..:|:|||::|..||| .:| :||||||:             
Zfish   539 SSSSTQRTCKNSEIEKITEDSTATTLEALKARIRELEKQILRGDRYKCLICMRKPTQTGADGKIQ 603

  Fly   351 --------------------------------------------DDYKNPAISVSCWHVHCEQCW 371
                                                        |.|..|..|:.|||||||:||
Zfish   604 AAERHGSAEALQLGVYCLYRGYVTGCSTATAGSSGIKKLLPLRRDSYTMPLTSIQCWHVHCEECW 668

  Fly   372 LQTLGARKLCPQCNSITTPKDLRRIYL 398
            |:|||.:|||||||:||:|.||||:||
Zfish   669 LRTLGNKKLCPQCNTITSPGDLRRVYL 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 87/291 (30%)
zf-C3HC4_2 346..384 CDD:290634 26/95 (27%)
rnf220aXP_021336297.1 RNF220 224..507 CDD:318197 88/292 (30%)
RING-HC_RNF220 648..682 CDD:319477 23/34 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C144321552
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1583675at2759
OrthoFinder 1 1.000 FOG0004755
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133932
Panther 1 1.100 LDO PTHR13459
Phylome 1 0.910 0.944 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5368
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.