DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and rnf220b

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_686354.5 Gene:rnf220b ZFINID:ZDB-GENE-081104-195 Length:588 Species:Danio rerio

Alignment Length:417 Identity:136/418 (33%)
Similarity:192/418 (46%) Gaps:92/418 (22%)


  Fly    25 ICPTCDVKIKRSQVADHCQVEMERL---HNP--------ISAVTPPTPTSGATASEESGSVSGGR 78
            :||.|...::..::.:|.:.|||||   ||.        :||..|.:..|.....|.|.|.|..|
Zfish   221 MCPICHAVLRSGELQEHMEQEMERLMQMHNSQGPAQKECLSAGPPKSLFSMHIKREGSSSASSPR 285

  Fly    79 --------QPWSVFQRVQRNRQARQRQR----TRKRPASPAPPATVNPTVAAAPPPAAATPSVAA 131
                    ..:..|.||:.|||.|...:    .|...........|.|....   |.|       
Zfish   286 PADEAVHSDRYQTFLRVRSNRQTRLNVKELCWCRCYAKHKVKSGHVWPDCGF---PHA------- 340

  Fly   132 AESSQPTCPVCNHNFPQSNIQEHVNHCLRQSRRNGQANGERHSSEDSEDSEEYEEYEWAGQKRIR 196
                 |:||:      .:.|.:.......:.:|:|..     ..||........|:|||.|:||:
Zfish   341 -----PSCPL------SARIGKLKRRKAEEEQRDGMC-----VVEDGSVISAGREFEWAEQRRIQ 389

  Fly   197 VSTLVQGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGDVIP-LVNE--DT 258
            :.::::|   ..||     .:.:.:...|.|.||:||.|||..||..||.|.|||| |.||  |.
Zfish   390 MVSVLRG---FRGL-----VSSTLKEHQDSDADLDVDGDDTLEYGKVQYTEADVIPCLGNEARDA 446

  Fly   259 E------GNVSEADVTSYV----RRLISS-----SDGPKPNHSSEATEQEPASTSNVEAPPASEE 308
            |      |.:...|.||..    .:|.:|     |:|...|:.|..:   |.:..|.|....|::
Zfish   447 EERQALRGAILNGDTTSRFSPEQTKLANSETPTTSNGEGDNNLSTTS---PRTCKNSELEILSDD 508

  Fly   309 PSTSRSTRSTSQNQQQIIESLKAKLRLYEKQ-AQG-KYKCLICIDDYKNPAISVSCWHVHCEQCW 371
            ||.:            .:|:||.::|..||| .:| ::|||||:|.|..|..|:.|||||||:||
Zfish   509 PSLN------------TLEALKTRIRDLEKQLTRGDRFKCLICMDCYTVPLTSIQCWHVHCEECW 561

  Fly   372 LQTLGARKLCPQCNSITTPKDLRRIYL 398
            |:||||:|||||||:||:|.||||:||
Zfish   562 LRTLGAKKLCPQCNTITSPGDLRRVYL 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 81/297 (27%)
zf-C3HC4_2 346..384 CDD:290634 27/38 (71%)
rnf220bXP_686354.5 RNF220 215..463 CDD:292548 76/276 (28%)
zf-C3HC4_2 536..574 CDD:290634 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IQH
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10036
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583675at2759
OrthoFinder 1 1.000 FOG0004755
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13459
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.