DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and RNF220

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_005271049.1 Gene:RNF220 HGNCID:25552 Length:592 Species:Homo sapiens

Alignment Length:408 Identity:146/409 (36%)
Similarity:201/409 (49%) Gaps:72/409 (18%)


  Fly    25 ICPTCDVKIKRSQVADHCQVEMERLHN-PIS-------AVTPPTPTS------------GATASE 69
            |||.|.|.::.|::.:|.:.|:|:|.. |.|       |:.|.||.|            ..|||.
Human   223 ICPICQVLLRPSELQEHMEQELEQLAQLPSSKNSLLKDAMAPGTPKSLLLSASIKREGESPTASP 287

  Fly    70 ESGSVSG--GRQPWSVFQRVQRNRQARQRQRTRKRPASPAPPATVNPTVAAAPPPAAATPSVAAA 132
            .|.:...  ....:..|.||:.|||.|...|..|..........|                    
Human   288 HSSATDDLHHSDRYQTFLRVRANRQTRLNARIGKMKRRKQDEGQV-------------------- 332

  Fly   133 ESSQPTCPVCNHNF--PQSNIQEHVNHCLRQSRRNGQANGERHSSE-DSEDSEEYEEYEWAGQKR 194
                  ||:||...  .:..:..||.|||  |:|.|....|..:.: :.|::..:|||||.||||
Human   333 ------CPLCNRPLAGSEQEMSRHVEHCL--SKREGSCMAEDDAVDIEHENNNRFEEYEWCGQKR 389

  Fly   195 IRVSTLVQGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGDVIPLVNEDTE 259
            ||.:||::||:...|.   |..:|.:  ..|.|.||:||.|||..||..||.|.||||...|:. 
Human   390 IRATTLLEGGFRGSGF---IMCSGKE--NPDSDADLDVDGDDTLEYGKPQYTEADVIPCTGEEP- 448

  Fly   260 GNVSEADVTSYVRRLISSSDGPK----PNHSSEATEQEPASTSNVEAPPASEEPSTSRST---RS 317
               .||.....:|..:.:...|.    |..|..|:::.| ||||.|:........|.:::   :.
Human   449 ---GEAKEREALRGAVLNGGPPSTRITPEFSKWASDEMP-STSNGESSKQEAMQKTCKNSDIEKI 509

  Fly   318 TSQNQQQIIESLKAKLRLYEKQ-AQG-KYKCLICIDDYKNPAISVSCWHVHCEQCWLQTLGARKL 380
            |..:.....|:|||::|..|:| ::| :||||||:|.|..|..|:.|||||||:|||:||||:||
Human   510 TEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKL 574

  Fly   381 CPQCNSITTPKDLRRIYL 398
            |||||:||.|.|||||||
Human   575 CPQCNTITAPGDLRRIYL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 85/281 (30%)
zf-C3HC4_2 346..384 CDD:290634 27/38 (71%)
RNF220XP_005271049.1 RNF220 217..468 CDD:318197 86/282 (30%)
RING-HC_RNF220 539..579 CDD:319477 29/40 (73%)
RING-HC finger (C3HC4-type) 540..578 CDD:319477 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C145561183
eggNOG 1 0.900 E1_28IQH
Hieranoid 1 1.000
Homologene 1 1.000 H10036
Inparanoid 1 1.050 196 1.000 Inparanoid score I3760
Isobase 1 0.950 0 Normalized mean entropy S6937
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583675at2759
OrthoFinder 1 1.000 FOG0004755
OrthoInspector 1 1.000 T1073860
orthoMCL 1 0.900 OOG5_133932
Panther 1 1.100 LDO PTHR13459
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5368
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.