DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and rnf220.1

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001016196.1 Gene:rnf220.1 XenbaseID:XB-GENE-485089 Length:301 Species:Xenopus tropicalis

Alignment Length:342 Identity:126/343 (37%)
Similarity:178/343 (52%) Gaps:55/343 (16%)


  Fly    70 ESGSVSGGRQPWSVFQRVQRNRQARQRQRTRKRPASPAPPATVNPTVAAAPPPAAATPSVAAAES 134
            :|.|.|.||:  ..|.||:.|||.|...|..|..........|                      
 Frog     2 QSESRSTGRE--ETFLRVRANRQTRLNARIGKMKRRKQDDGQV---------------------- 42

  Fly   135 SQPTCPVCNHNFPQSNIQE----HVNHCLRQSRRNGQANGERHSSEDSEDSEEYEEYEWAGQKRI 195
                ||:|:.  |.|..:|    ||..||  ::|....|.:.....::|:...:|||||.|||||
 Frog    43 ----CPLCSQ--PLSGSEEEMSRHVELCL--AKRETCMNEDDSVDIENENGNRFEEYEWCGQKRI 99

  Fly   196 RVSTLVQGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGDVIPLVNEDTEG 260
            |.:||::||:.    |......||:: ..|.|.||:||.|||..||..||.|.|:||...|:.  
 Frog   100 RATTLLEGGFR----GSGFVMCGSKE-NHDSDADLDVDGDDTLEYGKAQYTEADIIPCTGEEP-- 157

  Fly   261 NVSEADVTSYVRRLISSSDGPKPNHSSE----ATEQEPASTSNVEAPPASEEPSTSRST---RST 318
              .||.....:|..:.:...|....::|    |:::.| ||||.|:........|.:::   :.|
 Frog   158 --GEAKEREALRGAVLNGGTPSTRITTEFSKWASDEMP-STSNGESSKQETMQKTCKNSDIEKIT 219

  Fly   319 SQNQQQIIESLKAKLRLYEKQ-AQG-KYKCLICIDDYKNPAISVSCWHVHCEQCWLQTLGARKLC 381
            .::.....|:|||::|..|:| ::| :||||||:|.|..|..|:.|||||||:|||:||||:|||
 Frog   220 EESAVTTFEALKARIRELERQLSRGDRYKCLICMDSYTMPLTSIQCWHVHCEECWLRTLGAKKLC 284

  Fly   382 PQCNSITTPKDLRRIYL 398
            ||||:||:|.||||:||
 Frog   285 PQCNTITSPGDLRRVYL 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 67/215 (31%)
zf-C3HC4_2 346..384 CDD:290634 27/38 (71%)
rnf220.1NP_001016196.1 RNF220 <9..177 CDD:292548 65/209 (31%)
zf-C3HC4_2 249..287 CDD:290634 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C145799315
eggNOG 1 0.900 E1_28IQH
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10036
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1583675at2759
OrthoFinder 1 1.000 FOG0004755
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.900 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5368
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.