DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and Rnf220

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_017449286.1 Gene:Rnf220 RGDID:1598210 Length:592 Species:Rattus norvegicus

Alignment Length:408 Identity:145/409 (35%)
Similarity:201/409 (49%) Gaps:72/409 (18%)


  Fly    25 ICPTCDVKIKRSQVADHCQVEMERLHN-PIS-------AVTPPTPTS------------GATASE 69
            |||.|.|.::.|::.:|.:.|:|:|.. |.|       |:.|.||.|            ..|||.
  Rat   223 ICPICQVLLRPSELQEHMEQELEQLAQLPASKNSLLKDAMAPGTPKSLLLSASIKREGDSPTASP 287

  Fly    70 ESGSVSG--GRQPWSVFQRVQRNRQARQRQRTRKRPASPAPPATVNPTVAAAPPPAAATPSVAAA 132
            .|.:...  ....:..|.||:.|||.|...|..|..........|                    
  Rat   288 HSSATEDLHHSDRYQTFLRVRANRQTRLNARIGKMKRRKQDEGQV-------------------- 332

  Fly   133 ESSQPTCPVCNHNF--PQSNIQEHVNHCLRQSRRNGQANGERHSSE-DSEDSEEYEEYEWAGQKR 194
                  ||:|:...  .:..:..||.|||  |:|.|....|..:.: :.|:|..:|||||.||||
  Rat   333 ------CPLCSRPLAGSEQEMSRHVEHCL--SKREGSCVAEDDAVDIEHENSNRFEEYEWCGQKR 389

  Fly   195 IRVSTLVQGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGDVIPLVNEDTE 259
            ||.:||::||:...|.   :..:|.:  ..|.|.||:||.|||..||..||.|.||||...|:. 
  Rat   390 IRATTLLEGGFRGSGF---VMCSGKE--NPDSDADLDVDGDDTLEYGKPQYTEADVIPCTGEEP- 448

  Fly   260 GNVSEADVTSYVRRLISSSDGPK----PNHSSEATEQEPASTSNVEAPPASEEPSTSRST---RS 317
               .||.....:|..:.:...|.    |..|..|:::.| ||||.|:........|.:::   :.
  Rat   449 ---GEAKEREALRGAVLNGGPPSTRITPEFSKWASDEMP-STSNGESSKQEAMQKTCKNSDIEKI 509

  Fly   318 TSQNQQQIIESLKAKLRLYEKQ-AQG-KYKCLICIDDYKNPAISVSCWHVHCEQCWLQTLGARKL 380
            |..:.....|:|||::|..|:| ::| :||||||:|.|..|..|:.|||||||:|||:||||:||
  Rat   510 TEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKL 574

  Fly   381 CPQCNSITTPKDLRRIYL 398
            |||||:||.|.|||||||
  Rat   575 CPQCNTITAPGDLRRIYL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 84/281 (30%)
zf-C3HC4_2 346..384 CDD:290634 27/38 (71%)
Rnf220XP_017449286.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10036
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583675at2759
OrthoFinder 1 1.000 FOG0004755
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13459
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.