DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and tey

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001137981.1 Gene:tey FlyBaseID:FBgn0036899 Length:822 Species:Drosophila melanogaster

Alignment Length:432 Identity:92/433 (21%)
Similarity:143/433 (33%) Gaps:134/433 (31%)


  Fly    25 ICPTCDVKIKRSQVADHCQVEMERLHNPISA------------VTPPTPTSGATASEESGSVSGG 77
            :||.|.:|:...:...|...|::||:. :||            ..||.|     |.|.:...|..
  Fly   330 MCPVCGLKLSAEEWHTHFLTELDRLYK-LSAGFERASLQATYMFAPPCP-----AQENAIRTSHN 388

  Fly    78 RQPWSVFQRVQRNRQARQRQRTRKR-------------------------PASPAPP-------- 109
            |  |..|||::.|||.|.|.:.|||                         .....||        
  Fly   389 R--WETFQRIRNNRQNRLRLKVRKRKYGEMYMMESLYCSSCPICKRKYALETGKIPPEDDAKSQE 451

  Fly   110 --ATVNPTVAAAPPPAA----ATPSVAAAESSQPTCPVCNHNFPQSNIQEHVNHCLRQSRRNGQA 168
              .||:........|.:    ||||..::.:..|  |...||   ||.|.            |:.
  Fly   452 EIETVDVESCNDEVPDSGSELATPSSGSSGTVMP--PSSMHN---SNSQP------------GKL 499

  Fly   169 NG------------ERHSSED--SEDSEEYEEYEWAG----QKRIRVSTLVQGG------YSALG 209
            :|            :.|..|.  |.:........|.|    |..|.|.|:.:..      |:|..
  Fly   500 DGILYRTGCVLSQKDPHPDEHDVSTNVTTASSSSWPGEAPTQAHISVKTVSELSSTTHHYYNADS 564

  Fly   210 LGQRIKYNGSQQA-------------------QDDEDEDLNVDEDDT-HIYGPTQYGEGDVIPLV 254
            .|..:....|..:                   |:|.|||:.||:||| .:.....||:  :....
  Fly   565 CGVGVNDTNSSSSTHNNGGGSNKDLMMDTASCQNDSDEDVIVDDDDTVKLTSKINYGK--IQRRQ 627

  Fly   255 NEDTEG------NVSEADVTSYVRRLISSSD-GPKP----NHSSEATEQEPASTSNVEAPPASEE 308
            :|...|      |:|..:........:||:: ||..    |:::.......::::|...|.....
  Fly   628 DEQNVGSSRSLENISPVEERPRSEPQVSSTEPGPMDISHNNNNNNNNNNNNSNSNNNNNPSTKYA 692

  Fly   309 PSTSRSTRSTSQNQQQIIESLKAKLRL-YEKQAQGKYKCLIC 349
            .|...|....|......:..|..|:.: .:.:...:.||.||
  Fly   693 ESMENSLSQLSSMGVPGLTQLDTKVGISSDLKPDDENKCFIC 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 79/358 (22%)
zf-C3HC4_2 346..384 CDD:290634 3/5 (60%)
teyNP_001137981.1 RNF220 328..>459 CDD:292548 33/137 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146654047
eggNOG 1 0.900 E1_28IQH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13459
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.