DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4813 and LOC100492804

Sequence 1:NP_651088.1 Gene:CG4813 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_002940098.3 Gene:LOC100492804 XenbaseID:XB-GENE-22041736 Length:419 Species:Xenopus tropicalis

Alignment Length:327 Identity:82/328 (25%)
Similarity:138/328 (42%) Gaps:99/328 (30%)


  Fly   112 VNPTV--AAAPPPAAATPSVAAAESSQPT-CPVCNHNFPQSNIQEHV--------------NHC- 158
            |.||.  ::..|..:::.....::.|.|. ||:|:....:..:..||              :.| 
 Frog   152 VTPTSHRSSPKPRTSSSKRDKKSDGSLPLHCPLCHKYLQKEELSHHVEQEMDILTQQADSESDCP 216

  Fly   159 ------LRQSRRNGQANGERHSSEDSEDSEE------YEEYEW---------AGQ-KRIRVSTLV 201
                  |.||.:.|:.:........|||.::      |::.:|         ||: ||:||:   
 Frog   217 SEVTQNLTQSPKQGEDSASESPLTISEDGQKLDRQQIYQQIKWNREERLGARAGRCKRVRVT--- 278

  Fly   202 QGGYSALGLGQRIKYNGSQQAQDDEDEDLNVDEDDTHIYGPTQYGEGDVIPLVNEDTEGNVSEAD 266
                           ||..:                   |......||.       ::||..|.:
 Frog   279 ---------------NGEME-------------------GSPSVRNGDA-------SDGNHWEEE 302

  Fly   267 VTSYVRRLISSSDGPKPNHSSEATEQEPASTSNVEAPPASEEPSTSRSTRSTSQNQQQIIESLKA 331
            :.|..:.:.:.::......||.||:              |||..|...:..|:.| ::.:::|:.
 Frog   303 IRSSEKSMSADTECRGSPASSCATQ--------------SEESDTEEGSSCTTSN-EKCLKTLRD 352

  Fly   332 KLRLYEKQAQGKYKCLICIDDYKNPAISVSCWHVHCEQCWLQTLGARKLCPQCNSITTPKDLRRI 396
            |::...::.:..:.|.||:|.|..|..|:.|||:|||.|||:.||.:|||||||:||:|.||||:
 Frog   353 KIQELTEKLKNTHTCHICLDSYNIPVASIQCWHIHCEGCWLRALGTKKLCPQCNTITSPCDLRRV 417

  Fly   397 YL 398
            ||
 Frog   418 YL 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4813NP_651088.1 RNF220 22..281 CDD:292548 36/209 (17%)
zf-C3HC4_2 346..384 CDD:290634 23/38 (61%)
LOC100492804XP_002940098.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.