DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d4 and CYP72A11

Sequence 1:NP_651082.1 Gene:Cyp6d4 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_188083.1 Gene:CYP72A11 AraportID:AT3G14650 Length:512 Species:Arabidopsis thaliana

Alignment Length:554 Identity:125/555 (23%)
Similarity:216/555 (39%) Gaps:123/555 (22%)


  Fly    12 LTLAWFYLKRHYEYWERRGFPFEKHSGIPF----GCLD---SVWRQEKSMGLAIYD--------- 60
            |...||..|....|..|:|.     :|.|:    |.|.   |:..:.:|..:.:.|         
plant    25 LQWVWFKPKMLESYLRRQGL-----AGTPYTPLVGDLKKNFSMRAEARSKPINLTDDITPRIVPY 84

  Fly    61 --VYVKSKERVLGIYLLFRPAVLIRDADLARRVL--AQDFASFHDRGVYVDEERDPL----SANI 117
              ..:|:..|....:....|.:.|.|.:....||  ..||...|         ..||    :..:
plant    85 PLQMLKTHGRTFFTWFGAIPTITIMDPEQITEVLNKVYDFQKAH---------TFPLGRLIATGV 140

  Fly   118 FSLRGQSWRSMRHMLSPCFTSGKLKSMF-----STSEDI--GDKMVAHLQKELPEEGFKEVDIKK 175
            .|..|..|...|.:::|.|...|:|:|.     |.||.:  .||:|:      .:|...|||:..
plant   141 LSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEIVCKWDKLVS------DKESSCEVDVWP 199

  Fly   176 VMQNYAIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIF-LVPSIAQFL---- 235
            .:.:...|:|:.|.||                         .:.:.|..|| |...:||.:    
plant   200 GLVSMTADVISRTAFG-------------------------SSCVEGQRIFELQAELAQLIIQTV 239

  Fly   236 ---FRIGFK--------------NPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKID 283
               |..|:.              ..:.:.:..||.:.:..||.......|||.:|:: .|.|:..
plant   240 RKAFIPGYSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPNDDLLGILLE-SNLGQTK 303

  Fly   284 ENDEKSFSIQKTPDGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEV 348
            .|.                :|.|.:..:..:||..|||||.....:|:..|:|:.:...|.::||
plant   304 GNG----------------MSTEDLMEECKLFYFVGQETTSVLLVWTMVLLSQHQDWQARAREEV 352

  Fly   349 DETLAKNDGKITYDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVIS 413
            .:..  .|.:...:.||:::.:.:.:.|.:|.||.:|.|:|...::..:.|.  .:|.|..:.:.
plant   353 KQVF--GDKEPDAEGLNQLKVMTMILYEVLRLYPPIPQLSRAIHKEMELGDL--TLPGGVLINLP 413

  Fly   414 LYGIHHDAEYF-PDPETYDPERFSE--ESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKIL 475
            :..:..|.|.: .|...:.|:||.:  .....|..:|.||..|.||||.|....:.:|:|:..||
plant   414 ILLVQRDTELWGNDAGEFKPDRFKDGLSKATKNQASFFPFAWGSRICIGQNFALLEAKMAMALIL 478

  Fly   476 QNFNVEVMSRSEIEFENSGIALIPKHGVRVRLSK 509
            |.|:.| :|.|.:....:...:.|:.|..:.:.|
plant   479 QRFSFE-LSPSYVHAPYTVFTIHPQFGAPLIMHK 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 110/491 (22%)
CYP72A11NP_188083.1 p450 24..512 CDD:299894 125/555 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.