DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6d4 and Cyp3a23/3a1

Sequence 1:NP_651082.1 Gene:Cyp6d4 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_037237.2 Gene:Cyp3a23/3a1 RGDID:628626 Length:502 Species:Rattus norvegicus

Alignment Length:530 Identity:176/531 (33%)
Similarity:279/531 (53%) Gaps:96/531 (18%)


  Fly     5 ILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIP-FGCLDSVWRQEKSMGLAIYDVYVKSK-E 67
            :||||.|:.|..|..:.| ..::::|.|..|  .:| ||.:.:.:     |||..:||....| .
  Rat    13 VLLAVVLVLLYGFGTRTH-GLFKKQGIPGPK--PLPFFGTVLNYY-----MGLWKFDVECHKKYG 69

  Fly    68 RVLGIYLLFRPAVLIRDADLARRVLAQD-FASFHDR---------GVYVDEERDPLSANIFSLRG 122
            ::.|::....|...|.|.::.:.||.:: |:.|.:|         |..:...:|           
  Rat    70 KIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISVSKD----------- 123

  Fly   123 QSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIAS 187
            :.|:..|.:|||.||||:||.||...|..||.:|.:|::   |:| |.|.:|:|...|::|:|.|
  Rat   124 EEWKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQ---EKG-KPVPVKEVFGAYSMDVITS 184

  Fly   188 TIFGLDVNSFENPDNKF----RKLVSLARANNRFNAMFGMMIFLVPSIAQFLFRIGFKNPVGLAM 248
            |.||::|:|..||.:.|    :||:.:    :.|:.:| :.:.|.|          |..|| ..|
  Rat   185 TSFGVNVDSLNNPKDPFVEKAKKLLRI----DFFDPLF-LSVVLFP----------FLTPV-YEM 233

  Fly   249 LQIV---KETVE------YR---------EKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKT 295
            |.|.   |:::|      ||         :||   |.|.|||::...|    |..|::|      
  Rat   234 LNICMFPKDSIEFFKKFVYRMKETRLDSVQKH---RVDFLQLMMNAHN----DSKDKES------ 285

  Fly   296 PDGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKIT 360
               |.....:| ||||:.||..||.|.|.||.:|.::.||.:|:..|:||:|:|..| .|....|
  Rat   286 ---HTALSDME-ITAQSIIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRAL-PNKAPPT 345

  Fly   361 YDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHV-IPKGTPVVISLYGIHHDAEYF 424
            ||::.:||:||:.:.||:|.||....|.|.|.:|..:   |.| :|||:.|:|..|.:|.|.:::
  Rat   346 YDTVMEMEYLDMVLNETLRLYPIGNRLERVCKKDVEI---NGVFMPKGSVVMIPSYALHRDPQHW 407

  Fly   425 PDPETYDPERFSEESR-NYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVMSRSEI 488
            |:||.:.|||||:|:: :.:|..::|||.|||.||..|...:|.|||:.|:||||:.:....::|
  Rat   408 PEPEEFRPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQI 472

  Fly   489 EFENSGIALI 498
            ..:.|...|:
  Rat   473 PLKLSRQGLL 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 159/477 (33%)
Cyp3a23/3a1NP_037237.2 p450 39..492 CDD:278495 167/504 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.