DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and EPX

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_000493.1 Gene:EPX HGNCID:3423 Length:715 Species:Homo sapiens

Alignment Length:694 Identity:231/695 (33%)
Similarity:331/695 (48%) Gaps:111/695 (16%)


  Fly   129 ALGDREILEEGLQPNEVNTPSFRHYRSLSTNPEARKLARRGYVENQATIDIAKRFNYTKQPGRSN 193
            |||   :|||.|||.  .:..| :...:.|.|:.|.|::   ....|..|.|:|           
Human    96 ALG---LLEEKLQPQ--RSGPF-NVTDVLTEPQLRLLSQ---ASGCALRDQAER----------- 140

  Fly   194 IGWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAP-- 256
                              |  :.:||..||.||||:.| ..|||.....|.:..:|.||::.|  
Human   141 ------------------C--SDKYRTITGRCNNKRRP-LLGASNQALARWLPAEYEDGLSLPFG 184

  Fly   257 ----RVSHHGRLPPARQVSLKIHRSSYE---TDSNFTVMLAVFGQFMDHDITATSLTTSQEG--E 312
                |..:...||..|.||.:|.|...|   :|....:|...:|||:|||:..:..:.::..  .
Human   185 WTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTA 249

  Fly   313 SIDCCVAATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAPA-PTGRFGPRMQLNQATAFIDA 376
            .:||  ..|..|.|.|:|:.|.|:||..|... .|:.|.||||: |..:...|.|:|..|:|:||
Human   250 GVDC--ERTCAQLPPCFPIKIPPNDPRIKNQR-DCIPFFRSAPSCPQNKNRVRNQINALTSFVDA 311

  Fly   377 SVVYGN-------LEQRQNQLRSFINGSLRMFVTDDGRQLLPISSNPADGC---NRVQMTRLGKY 431
            |:|||:       |..|.|.|...   ::.....|:||.|||..:...|.|   ||  ..|:.  
Human   312 SMVYGSEVSLSLRLRNRTNYLGLL---AINQRFQDNGRALLPFDNLHDDPCLLTNR--SARIP-- 369

  Fly   432 CFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEF 496
            ||.:||.|:.|...|.:||.|:.|.||.||.:|:..||.|..::||.|||||:||.:..|||.:|
Human   370 CFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDF 434

  Fly   497 LPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLL-PGLFNIS---RD 557
            ||::|||        ..|:..|.....|...|||.:||.| ..||||.||:| |.:|.:.   |.
Human   435 LPLVLGK--------ARARRTLGHYRGYCSNVDPRVANVF-TLAFRFGHTMLQPFMFRLDSQYRA 490

  Fly   558 NSTPEAIELHKMLFNPFSLWAEHGIDHALMTAANTP-------VMQVDRFFSLEVTQKLFEGTAE 615
            ::....:.|....|..:.:..|.|||..|.....||       .|.||     |:..:||.    
Human   491 SAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVD-----ELRDRLFR---- 546

  Fly   616 DRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQ 679
             :|...||||.:||:||.||||:|.|..:||.|.|.......::|:.:.|..| .....:|.:|.
Human   547 -QVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGTPD 610

  Fly   680 DVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLA 744
            ::|::.||::||.|.||..||||:|:..:||.|.:.||..|::::   ..|||.|...:.:.||:
Human   611 NIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKR---GVFTKRQRKALSRISLS 672

  Fly   745 AIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPW 788
            .|||.|: |||.|...:. |........|:|..:.  ..|...|
Human   673 RIICDNT-GITTVSRDIF-RANIYPRGFVNCSRIP--RLNLSAW 712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 205/571 (36%)
peroxinectin_like 364..750 CDD:188655 149/408 (37%)
EPXNP_000493.1 An_peroxidase 145..683 CDD:281139 206/572 (36%)
myeloperoxidase_like 289..699 CDD:188656 157/441 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5081
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.