DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and Lpo

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_536345.2 Gene:Lpo MGIID:1923363 Length:710 Species:Mus musculus

Alignment Length:733 Identity:223/734 (30%)
Similarity:347/734 (47%) Gaps:87/734 (12%)


  Fly   101 DEPAAEWALQQAALGHHDGAQAVSAGI-KA-LGDREILEEGLQPNEVNTPSFRHYRSLS-----T 158
            |:|.||..:      .||..:.|...: || |..|:.|:..:      |......|.||     .
Mouse    25 DDPTAETDI------IHDTVEEVKVWVNKAFLDSRDRLKMAM------TTKIHSTRHLSDYLKHA 77

  Fly   159 NPEARKLARRGYVENQATIDIAKRF-NYTKQP-GRSNIGWGPKIVLPDPTVLRLECDFNARYRRS 221
            ....|...|.|.|..::...:::.. |.|.|. ..:.:.|......|.||   :.|:.::.||..
Mouse    78 KGRTRTAIRSGQVWEESLKKLSQFLTNVTGQGLDLTLLSWEAGCDPPAPT---MTCNISSPYRTI 139

  Fly   222 TGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAP------RVSHHGRLPPARQVSLKIHRSSYE 280
            ||.|||:::| ..|::.....|.:..:|.||::.|      ::.:...||..|:||.:|.....|
Mouse   140 TGYCNNRKNP-ALGSANRALARWLPAEYEDGLSLPYGWTPGKMRNGFPLPQPREVSNQIAAYLNE 203

  Fly   281 ---TDSNFTVMLAVFGQFMDHDI-----TATSLTTSQEGESIDCCVAATREQHPECYPVDILPDD 337
               .|...:::...:||.:|||:     |.....|..:.:..:.|:     |...|:|:...|.|
Mouse   204 EDVLDQKRSMLFMQWGQIVDHDMDFAPETEMGSDTYTKAQCDEHCI-----QGDNCFPIMFPPGD 263

  Fly   338 PYYKQYNISCMNFVRS---APAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLR 399
            |..|... .||.|.|:   .|.|..:...|.|:|..|:|:|||:||.......|:||: ::..|.
Mouse   264 PKLKTQG-KCMPFFRAGFVCPTPPYKSLAREQINALTSFLDASLVYSPEPSLANRLRN-LSSPLG 326

  Fly   400 MF-----VTDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNY 459
            :.     |:|:||...|........|..:..| .|..||.:||.||:|.:||.:.|.|:.|.||.
Mouse   327 LMAVNEEVSDNGRPFPPFVKMKPSPCEVINAT-AGVPCFLAGDSRASEQILLATSHTLFIREHNR 390

  Fly   460 LARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTY 524
            ||.:|...||||:.|.||||||||:||.:...|:.::||:|||   .|.:..:|....      |
Mouse   391 LATELSRLNPHWDRETLYQEARKIMGAFIQITTFRDYLPILLG---DEMQKWIPPYQG------Y 446

  Fly   525 DPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNSTP----EAIELHKMLFNPFSLWAEHGIDHA 585
            :..|||.|:|.| ..|.||.|..:|.......:|..|    ..:.||.:.||.:.|..:.|||..
Mouse   447 NESVDPRISNVF-TFALRFGHLEIPSTVYRLDENYQPWGSESELPLHTVFFNTWRLVKDGGIDPL 510

  Fly   586 L--MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHC 648
            :  :.|.|..:|..::..:.|:..|||    :....:.|.||.|:||||.||||.|.|..:|..|
Mouse   511 VRGLLAKNAKLMHQNKMMTGELRNKLF----QPNHTIHGFDLASINIQRSRDHGQPGYNSWRAFC 571

  Fly   649 RLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLR 712
            .|....|.||:|..:.|..| ..:..:|.:|.::|::.||::||.:.....||||:|::..||.|
Mouse   572 GLSQPKTLEELSAVMKNEVLAKKLMDLYGTPSNIDIWLGAVAEPLVHRGRVGPLLTCLLGQQFQR 636

  Fly   713 LKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPH--VDC 775
            ::.||..|:|   .|..||:.|...:.|.|.:.::|.|: ||.:|..:..|.   ...||  |||
Mouse   637 IRDGDRFWWE---NPGVFTEKQRESLQKMSFSRLVCDNT-GIDKVPLNPFQA---NAYPHGFVDC 694

  Fly   776 QDLEGFHFNFEPWSEKQQ 793
            ..::  ..:..||:..::
Mouse   695 SSID--KLDLSPWASVKE 710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 186/566 (33%)
peroxinectin_like 364..750 CDD:188655 140/398 (35%)
LpoNP_536345.2 An_peroxidase 136..672 CDD:281139 184/562 (33%)
myeloperoxidase_like 281..692 CDD:188656 149/434 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 310 1.000 Inparanoid score I2565
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.