DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and Pxdn

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_006515268.1 Gene:Pxdn MGIID:1916925 Length:1503 Species:Mus musculus

Alignment Length:830 Identity:264/831 (32%)
Similarity:384/831 (46%) Gaps:181/831 (22%)


  Fly    80 PSFFFVVNGSDSELAPNRPLP------DEPAAEWALQQAALGHHDGAQAVSAGIKALGDREILEE 138
            |.|..:.:....|:..|..||      .|||..|        :.||.|...:     |...|..|
Mouse   550 PVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITW--------NKDGVQVTES-----GKFHISPE 601

  Fly   139 G-LQPNEVNTPSFRHYRSLSTN---------------PEARKLARRG-------YVENQATI--- 177
            | |..|:|.|.....|..::.|               |:   ::|.|       .||..||:   
Mouse   602 GFLTINDVGTADAGRYECVARNTIGYASVSMVLSVNVPD---VSRNGDPYVATSIVEAIATVDRA 663

  Fly   178 -----------------DIAKRFNYTKQP---GRSNIGWGPKIV--------------------- 201
                             |:...|.|.:.|   |::..|   :|.                     
Mouse   664 INSTRTHLFDSRPRSPNDLLALFRYPRDPYTVGQARAG---EIFERTLQLIQEHVQHGLMVDLNG 725

  Fly   202 -------LPDPTVLRL--------------ECD---FNARYRRSTGVCNNKQHPRTYGASMVPYR 242
                   |..|..|.|              .|.   |:.:||...|.|||.||| .:|||:..:.
Mouse   726 TSYHYNDLVSPQYLSLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHP-MWGASLTAFE 789

  Fly   243 RMVSPDYADGIAAPRVSHHGR------LPPARQVSLKIHRSSYET-DSNFTVMLAVFGQFMDHDI 300
            |::...|.:|...||..:..|      ||..|.||..:..:...| |..||.||..:|||:|||:
Mouse   790 RLLKAVYENGFNTPRGINSQRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDL 854

  Fly   301 TATSLTTSQ----EGESIDCCVAATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAP-APTGR 360
            .:|.:..||    :|:  .|....:.:  |.|:.|.|.|:||..:. ...||.||||:| ..:|.
Mouse   855 DSTVVALSQARFSDGQ--HCSSVCSND--PPCFSVMIPPNDPRVRS-GARCMFFVRSSPVCGSGM 914

  Fly   361 FG-------PRMQLNQATAFIDASVVYGNLEQRQNQLRSFIN--GSLRM-FVTDDGRQLLPISSN 415
            ..       ||.|:||.|::||||.|||:.:.....:|...:  |.||. .|...|:.|||.::.
Mouse   915 TSLLMNSVYPREQINQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATG 979

  Fly   416 PADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEA 480
            |...|.|.: ......||.:||.||||.|.|||||.||.|.||.:|.:|.:.||||:.:.:|.|.
Mouse   980 PPTECMRDE-NESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHET 1043

  Fly   481 RKILGAQMAHITYNEFLPVLLG----KNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAF 541
            |||:||::.||||..:||.:||    |.:.|.:|             |||.|:..|.|.||.|||
Mouse  1044 RKIVGAEIQHITYRHWLPKILGEVGMKMLGEYRG-------------YDPSVNAGIFNAFATAAF 1095

  Fly   542 RFAHTLL-PGLFNISRD-NSTPEA-IELHKMLFNPFSLWAEHGID---HALMTAANTPVMQV-DR 599
            ||.|||: |.|:.:..: ...|:. :.|||..|:||.:..|.|||   ..|...|..  |:: .:
Mouse  1096 RFGHTLINPLLYRLDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGK--MRIPSQ 1158

  Fly   600 FFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAID 664
            ..:.|:|::||     .......|||.::|||||||||||.|..:|.:|.|....|:|::...|.
Mouse  1159 LLNTELTERLF-----SMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIK 1218

  Fly   665 NATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQ 728
            :..: :.::::|.|..::|::...:.|..:.|:..||.|.|::|.||.||:.||..|||   .|.
Mouse  1219 SPVIREKLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYE---NPG 1280

  Fly   729 KFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQDL 778
            .|:.|||.::.:||||.|:|.|||.||||::.|. |:.:..:.:..|:|:
Mouse  1281 VFSPAQLTQLKQTSLARILCDNSDNITRVQQDVF-RVAEFPHGYSSCEDI 1329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 214/571 (37%)
peroxinectin_like 364..750 CDD:188655 154/401 (38%)
PxdnXP_006515268.1 leucine-rich repeat 94..112 CDD:275380
leucine-rich repeat 113..127 CDD:275378
LRR_4 159..200 CDD:289563
LRR_8 160..219 CDD:290566
leucine-rich repeat 161..184 CDD:275378
leucine-rich repeat 185..208 CDD:275378
leucine-rich repeat 209..221 CDD:275378
TPKR_C2 217..268 CDD:301599
Ig 271..358 CDD:299845
I-set 271..358 CDD:254352
I-set 367..454 CDD:254352
Ig 371..454 CDD:299845
I-set 458..544 CDD:254352
Ig3_Peroxidasin 471..544 CDD:143222
I-set 550..636 CDD:254352 23/99 (23%)
Ig4_Peroxidasin 567..635 CDD:143223 19/81 (23%)
An_peroxidase 766..1307 CDD:281139 214/571 (37%)
peroxidasin_like 889..1328 CDD:188658 176/465 (38%)
VWC 1439..1494 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.