DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and tpo

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_021322945.1 Gene:tpo ZFINID:ZDB-GENE-110519-2 Length:672 Species:Danio rerio

Alignment Length:714 Identity:241/715 (34%)
Similarity:356/715 (50%) Gaps:118/715 (17%)


  Fly   147 TPSFRHYRSLSTNP--EARKLARRGYVENQATIDIAKRFNYTKQPGRS----------------N 193
            :|| :.|| ||..|  |.::::|...: .|.|:.:.|..:..:| .||                |
Zfish    18 SPS-QMYR-LSRRPSAETQQVSRSAEI-FQTTLTLLKEKSSRRQ-RRSVQISEVLSVKAVERIAN 78

  Fly   194 IGWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRV 258
            :...|:      |.....|..:..||..||||||:::| .:|::.....|.:..:|.||...|:.
Zfish    79 LSGCPR------TFQSTTCATDEEYRSITGVCNNRKNP-FWGSANTGLARWLPAEYEDGENQPKG 136

  Fly   259 SHHGR------LPPARQVSLKIHRSS---YETDSNFTVMLAVFGQFMDHDITATSLTTSQEG--E 312
            .:.||      |||.|:||.:|.|||   .:.|.:::.||..:||::||||:.|..::||..  .
Zfish   137 WNAGRQYNGFQLPPVREVSKRIIRSSSSALQEDRDYSQMLVDWGQYIDHDISFTPQSSSQTSFTP 201

  Fly   313 SIDC---CVAATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFI 374
            ..||   ||:|     ..|:|:.|..|||..:  |.||:.|.||:|:.||.  .|.|||..|:||
Zfish   202 GFDCLRTCVSA-----DPCFPIQISRDDPLSR--NSSCLPFFRSSPSCTGL--QRQQLNSITSFI 257

  Fly   375 DASVVYGNLEQRQNQLRSFINGSLRMF--VTDDGRQLLPISSNPADGC-----------NRVQMT 426
            |||.|||:.|::|..||| ..|.|.:.  ..|.||..||........|           .||:  
Zfish   258 DASTVYGSSEEQQQILRS-STGLLAVSEEFWDTGRPFLPSVPQRPSACLQQPGSPALLEARVE-- 319

  Fly   427 RLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHI 491
                 ||.:||.|.||.|.|..:|.||.|.||.||..|.:.|.||..:|:|||.|||:||.....
Zfish   320 -----CFAAGDSRVNEVLPLAVLHTLWMREHNRLAELLAQINTHWGKQRVYQETRKIIGALHQIF 379

  Fly   492 TYNEFLPVLLG-KNISEAKGLLPAKHNLNAP-DTYDPEVDPSIANCFAAAAFRFAH-TLLPGLFN 553
            |..:::|.::| ::::|..|          | :.|:..||||::|.||.|||||.| |:.|.|..
Zfish   380 TMRDYIPKVIGQESVNEFLG----------PYEGYNESVDPSVSNVFATAAFRFGHVTISPYLRR 434

  Fly   554 IS---RDNSTPEAIELHKMLFNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAE 615
            ::   :::...|.:.|.:..|:|:.|..|.|:|..|....:.|.:..|:...:  |::|.|....
Zfish   435 LNQSFQEDERYETLTLQQSFFSPWRLVREGGLDPVLRALLSAPAVLQDQEHLM--TEELTERLLV 497

  Fly   616 DRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQ 679
            ..||. .|||.:||:|||||||:|.|..:|..|.|..|::..::.:.:.:..| ..|..:|..|.
Zfish   498 LNVPQ-NLDLAALNLQRGRDHGLPGYNAWRVFCGLDRVESRSDLLKLVGSDDLVKEIMDLYGHPD 561

  Fly   680 DVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLA 744
            :|||:.|.|.|.||.||..|||.||::..|..:|:.||..|:   :.|..|:..|..|:...||:
Zfish   562 NVDVWLGGLLERPLSGARTGPLFSCLIGKQMKKLRDGDRFWW---LNPGVFSAEQRHELQTHSLS 623

  Fly   745 AIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFH-------FNFEPWSEKQQPQDLHSAG 801
            .:||.|| |:..|   .:...|....|       |.||       .:.|.|  ::||.|  :||
Zfish   624 RVICDNS-GLMEV---PLDAFRRSSYP-------EDFHLCGSVPTLDLEAW--REQPDD--AAG 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 209/571 (37%)
peroxinectin_like 364..750 CDD:188655 147/406 (36%)
tpoXP_021322945.1 An_peroxidase_like 113..665 CDD:326323 208/598 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.