DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and ptgs2b

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001020675.1 Gene:ptgs2b ZFINID:ZDB-GENE-041014-323 Length:606 Species:Danio rerio

Alignment Length:657 Identity:130/658 (20%)
Similarity:219/658 (33%) Gaps:184/658 (28%)


  Fly   142 PNEVNTPSFRHYRSLSTNPEARKLARRGYVENQAT-----IDIAKRFN----YTKQPGRSNIGWG 197
            ||.|:. ...|::||..........|.|.:....|     ||....||    |......||:.:.
Zfish    73 PNTVHY-ILTHFKSLWNIINNVSFLRNGIMRYVLTSRAHLIDSPPTFNADYGYKSWEAYSNLSYY 136

  Fly   198 PKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRT-YGASMVPYRRMVSPDYADGIAAPRVSHH 261
            .:.:.|.|.    :|.      ...||...|:.|.. ..|..:..||...||             
Zfish   137 TRTLPPVPR----DCP------TPMGVAGKKELPDVKMLAEKLLLRRKFIPD------------- 178

  Fly   262 GRLPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHP 326
                |.|.                .:|.|.|.|...|.                           
Zfish   179 ----PQRT----------------NLMFAFFAQHFTHQ--------------------------- 196

  Fly   327 ECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLR 391
                        ::|       :.::..||.|      ..||..   :|.:.:||....||::||
Zfish   197 ------------FFK-------SDMKKGPAFT------TALNHG---VDLAHIYGQNLDRQHKLR 233

  Fly   392 SFINGSLRMFVTDDGRQLLPISSNPADGCN---RVQMTRLGKYCFESGDDRANENLLLTSMHLLW 453
            .|.:|.||..:. ||....|..|......:   .|..:|.    |..|.:.......|.....:|
Zfish   234 LFKDGKLRYQIL-DGEVYPPTVSEVQVDMHYPPHVPESRR----FAVGHEAFGLVPGLMMYATIW 293

  Fly   454 ARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNL 518
            .|.||.:...|::::|.|:||||:|.:|.||..:...|...:::..|.|.....           
Zfish   294 LREHNRVCDILKQEHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYYFKL----------- 347

  Fly   519 NAPDTYDPEVDPSIANCFAAAAFRFA-------------HTLLPGLFNISRDNSTPEAIELHKML 570
                .:|||:   :.|    ..|::.             |.|:|..|:|.     .|.....:.|
Zfish   348 ----KFDPEL---LFN----ERFQYQNRISSEFNTLYHWHPLMPDDFHIQ-----DEVYNYQQFL 396

  Fly   571 FNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRD 635
            ||. |:..::|::..:.:            |:.::..::..|.   .|....|.:...:|:..|.
Zfish   397 FNT-SILTDYGVNSLVES------------FNKQIAGRVAGGR---NVAPAVLRVAIKSIENSRQ 445

  Fly   636 HGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGP 700
            ....|...:|:...:....::|||:...:.|.  .:.::|.....|::|.|.|.|.|...||||.
Zfish   446 MRYQSINAYRKRFNMKPYRSFEEMTGEKEMAA--ELEEMYGDVDAVELYAGLLVEKPRSNAIFGE 508

  Fly   701 LLSCMVSDQFLRLKLGD-----SHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREH 760
            .:..|.:...|:..:|:     .:|.....|    .|.....:...||..::|.|.:|...:...
Zfish   509 TMVEMGAPYSLKGLMGNPICSPEYWKPSTFG----GKVGFEIVNSASLQNLVCNNVNGPCPMASF 569

  Fly   761 VMQRLRD 767
            .:..::|
Zfish   570 YVPNVKD 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 110/559 (20%)
peroxinectin_like 364..750 CDD:188655 88/407 (22%)
ptgs2bNP_001020675.1 EGF_CA 21..57 CDD:238011
prostaglandin_endoperoxide_synthase 77..565 CDD:188648 126/641 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.