DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and Pxt

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_650648.3 Gene:Pxt FlyBaseID:FBgn0261987 Length:809 Species:Drosophila melanogaster

Alignment Length:587 Identity:208/588 (35%)
Similarity:310/588 (53%) Gaps:32/588 (5%)


  Fly   218 YRRSTGVCNNKQHPRT-YGASMVPYRRMVSPDYADGIAAPRVSHHGRLP--PARQVSLKIHRSSY 279
            ||...|.|||.:..|: :||:..|..||:.|.|.|||..||.......|  .||::|..:.....
  Fly   237 YRSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDGTPLLGARKISRTLLSDVD 301

  Fly   280 ETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCC-----VAATREQ-HPECYPVDILPDDP 338
            .....:.:|:..|||.:.|||:.||....::|..:.||     ||.:.:| |..|.|:.:.|||.
  Fly   302 RPHPKYNLMVMQFGQVLAHDISQTSSIRLEDGSLVQCCSPEGKVALSPQQSHFACMPIHVEPDDE 366

  Fly   339 YYKQYNISCMNFVRSA--PAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMF 401
            ::..:.:.|:||||.:  |:|..:.....||.:.|.|:|||.|||:.::....||:|..|.||| 
  Fly   367 FFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSSDEASRSLRAFRGGRLRM- 430

  Fly   402 VTDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQE 466
            :.|.||.|||: :|....|   .....||.||.|||.|.|:.:.|.::.:|.||.||.:|..|.|
  Fly   431 MNDFGRDLLPL-TNDKKAC---PSEEAGKSCFHSGDGRTNQIISLITLQILLAREHNRVAGALHE 491

  Fly   467 QNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPS 531
            .||...||.|:||||:|:.|:|.|||||||||:::|....:...|:|. |...:.| |:..|:|:
  Fly   492 LNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGPQQMKRFRLVPL-HQGYSHD-YNVNVNPA 554

  Fly   532 IANCFAAAAFRFAHTLLPGLFNISRDNS-TPEAIELHKMLFNPFSLWAEHGIDHALMTAANTPVM 595
            |.|.|:.||:|..|:.:.|.|.|.:::. ..|.:.:..::|||..:......|..|.|..:.|:.
  Fly   555 ITNEFSGAAYRMGHSSVDGKFQIRQEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQ 619

  Fly   596 QVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMS 660
            |||...|..:::.||.|..    |. ||||.::|||||||.|:.||..:......|.:.::|:..
  Fly   620 QVDSSISQGLSRFLFRGDN----PF-GLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQFP 679

  Fly   661 QAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKM 725
            ..|    ...:.::|.:|.|:|::.|.|.|..::|.:.|...:.:::|||.|.|.||.::||...
  Fly   680 IEI----AQKLSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARFKQGDRYYYEYDN 740

  Fly   726 G--PQKFTKAQLAEIYKTSLAAIICRNSDGIT--RVREHVMQRLRDGGNPHVDCQDLEGFHFNFE 786
            |  |..|...||.||.|.:||.::|.|||.:|  .|......|....||..:.|.|......|.|
  Fly   741 GINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPLAAFVRADHPGNQMIGCDDPNLPSVNLE 805

  Fly   787 PW 788
            .|
  Fly   806 AW 807

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 198/551 (36%)
peroxinectin_like 364..750 CDD:188655 144/389 (37%)
PxtNP_650648.3 GH64-TLP-SF <67..119 CDD:295337
An_peroxidase 237..772 CDD:281139 198/551 (36%)
peroxinectin_like 396..767 CDD:188655 144/387 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2019
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11475
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.