DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and cysu

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_650627.1 Gene:cysu FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster

Alignment Length:638 Identity:245/639 (38%)
Similarity:348/639 (54%) Gaps:40/639 (6%)


  Fly   160 PEARKLARRGYVENQATIDIAKRFNYTKQPGRSNIGWGPKIVLPDPTVLR---------LECDFN 215
            ||  :||..|.:....:|.:|:.:..:.:    .|..|...:....|::|         :||. .
  Fly    95 PE--ELATVGELLLDISIQLARTYGLSYE----EIEKGLPTIDTSKTLIREVCPPFFAGVECR-P 152

  Fly   216 ARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHGR-LPPARQVSLKIHRSSY 279
            .:|||..|:|||.:|| |:||:..|::|::.|.|:|||.|||:|..|| ||.:|.||..:|....
  Fly   153 GKYRRFDGLCNNIEHP-TWGAANAPFQRLIGPLYSDGINAPRISVTGRDLPFSRVVSRTMHPDDG 216

  Fly   280 ETDSNFTVMLAVFGQFMDHD--ITATSLTTSQEGESIDCCVAATREQHPECYPVDILPDDPYYKQ 342
            ..|...|||:..:|||||||  :|.|.|......:..:||......:||.|..:.|..||.:|:.
  Fly   217 FHDHAGTVMVIAWGQFMDHDFTLTGTPLDPINRNDPEECCKRPLHLKHPYCNEIRIPDDDYFYRL 281

  Fly   343 YNISCMNFVRSAPAPTG--RFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRM---FV 402
            :|:.|::|||..|:|..  :.|.|.|.|..|..|||:.|||..|....:||:...|.:||   |.
  Fly   282 FNVKCIDFVRGFPSPRPGCKLGSRQQFNTLTGVIDANTVYGVKESFARKLRTGYGGLMRMNPVFQ 346

  Fly   403 TDDGRQLLPISSN-PADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQE 466
            ....:.|||:..: |.:||.|...:   .||||.|:.|.||.|:||.||.|.||.||.||..|.:
  Fly   347 EYGLKDLLPLKLDIPDEGCTRPNKS---MYCFEGGEIRVNEQLVLTCMHTLMAREHNRLATALAQ 408

  Fly   467 QNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPS 531
            .|.||:||.|:||||:|..|.:.|:|:|||||:||||.:.|..||:..|...  .|.||..|:|.
  Fly   409 INKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKFGLVLQKDGY--WDGYDSTVNPG 471

  Fly   532 IANCFAAAAFRFAHTLLP-GLFNISRDNSTPEAIELHKMLFNPFSLWAEHGIDHALMTAANTPVM 595
            |.:.||.|||||.|:||| .:...|:.:....:..|..::..|:.|:....:|...|...|....
  Fly   472 IIDSFAGAAFRFGHSLLPTAVERWSKAHKFIASKRLSDLIRRPYDLYRAGVLDEYFMGLMNQVAQ 536

  Fly   596 QVDRFFSLEVTQKLF--EGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEE 658
            .:|...:.|||..||  ||..      .|:||||.|:||||:.|||.|..||:.|.|||.:||:|
  Fly   537 AMDDSITQEVTNHLFKKEGAR------FGMDLVSFNMQRGREFGIPGYMEFRKFCGLPTSNTWDE 595

  Fly   659 MSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYER 723
            |..::.|.|:.....|:|.|.|:|:::|.:||..|.|::.||..:|:::.|...|:.||..|||.
  Fly   596 MYGSMPNETVLRYGSIFEHPADIDLWSGGVSEKSLPGSMLGPTFACVIATQMSYLRRGDRFWYEL 660

  Fly   724 KMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQ 776
            ...|..||..||.||.|..|:.:||.|:|.|..|:.:.|.......||.|.|:
  Fly   661 PNQPSSFTPEQLQEIRKAKLSRLICDNTDLIDTVQIYPMVLPDHEINPRVPCK 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 226/549 (41%)
peroxinectin_like 364..750 CDD:188655 161/393 (41%)
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 226/549 (41%)
peroxinectin_like 305..687 CDD:188655 161/393 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2019
Isobase 1 0.950 0 Normalized mean entropy S5081
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11475
RoundUp 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.