DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and Irc

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001262653.1 Gene:Irc FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster

Alignment Length:789 Identity:215/790 (27%)
Similarity:354/790 (45%) Gaps:156/790 (20%)


  Fly    52 GITFIAIVFTALCLALVFSDSLGGADGGPSFFFVVNGSDSELAPNRPLPDEPAAEWALQQAALGH 116
            ||.:|.:      ||.:.         |.|....::.:.|. ..|..|...||::|         
  Fly     3 GIQYICL------LAFII---------GASLLTTIDANSSR-DVNAELNRIPASKW--------- 42

  Fly   117 HDGAQAVSAGIKALGDREILEEGLQPNE--VNTPSFRHYRSLSTNPEARKLARRGYVENQATIDI 179
               .|.|...:.::..::.||:.|..::  |...|..|.:.|.|.|   .||.:  .:|:..:.|
  Fly    43 ---LQYVETALDSVNRQKRLEDNLLGSDITVKNGSLSHAQLLDTLP---SLASK--KDNKLALKI 99

  Fly   180 AKR----FNYTKQPG-------RSNIGWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRT 233
            .|.    ||....|.       ||.:...|   ||:.:.||.||:.:.:       .|.:.|   
  Fly   100 LKSSLLVFNSECLPNNIDGDKCRSYLEQKP---LPEGSSLRTECENSLK-------GNREGH--- 151

  Fly   234 YGASMVPYRRMV-SPDYADGI--AAPRVSHHGRLPPARQVSLKIHR------SSYET-DSNFTVM 288
                 ..:||:: |..|.:|.  ..|.......:|.|..:|.:::.      |..:| :||..:.
  Fly   152 -----YAFRRLLGSSHYRNGFYQMFPNSGRRETVPAAWSISKELYEPDHIQISKQQTFESNSNLA 211

  Fly   289 LAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQ--------HPECYPVDILPDDPYYKQYNI 345
            |..:.||::||::.....:...|..|:||   :|:|        ||.|.|:...|..    :|::
  Fly   212 LPQWAQFVEHDLSKPVSQSMSNGAPIECC---SRDQINLQPRHHHPACAPILYQPGG----KYDV 269

  Fly   346 -SCMNFVRSAPAPTG-RFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTDDG-- 406
             ||:|:||||.|... .||...||||||..:|.|.:||.....:.:||....|.||.  |..|  
  Fly   270 PSCLNYVRSALAVADCNFGGAEQLNQATGSLDLSQLYGFTAAAERKLRVLEGGLLRS--TPRGEF 332

  Fly   407 -RQLLPISSNPADGCNRVQMTRLGK-YCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNP 469
             ..||||::: .:|.:......:|. .||.:||.|.|.:.....::.::.|:||.:|.:|:::||
  Fly   333 DNALLPIATD-TEGPSFCARATIGDGTCFAAGDSRVNSSPFSILIYTIFMRNHNKVAAELKQRNP 396

  Fly   470 HWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIAN 534
            .|.||:|:|.|:.:.......:...|:||.:||:.:|..   :..|         .|.....::|
  Fly   397 RWSDEKLFQAAKAVNVDIYRRVVIEEWLPEVLGQKMSSE---IRRK---------QPNRALEVSN 449

  Fly   535 CFAAAAFRFAHTLLPG-LFNISRDN------------------STPEAIELHKMLFNPFSLWAEH 580
            .||.||.||..::||. |.|:::||                  .|....||.:.::.|...:...
  Fly   450 EFAVAAIRFYFSMLPNELLNLTKDNVVYGTEKNNQYVFISKELPTKNLFELKEEIYKPKLQYTSQ 514

  Fly   581 GIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFR 645
            .:::.|.:..|...|::|..:|..|...      :|..| ...|:::.:||||||||:..|..:.
  Fly   515 KLNNILESLLNQETMKMDAAYSGGVVWH------KDTKP-THADILAFDIQRGRDHGLLPYYRYL 572

  Fly   646 RHCRLP-TVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQ 709
            ..|.|. .|::|::....|.:..||.::.||.|..|||:..|.:||.|:.|:| ||..||::|:|
  Fly   573 ESCVLSRPVESWKDFEHFIPSDVLDKLKTIYASWADVDLIVGGISENPVHGSI-GPTFSCIISEQ 636

  Fly   710 FLR-LKLGDSHWYERKMGPQKFTKAQLAEIYK----TSLAAIICRNSDGITRVREHVMQRLRDGG 769
            |:. ||      ..::...||.|  :|.|.|:    |.|   :|.|| |::.|.:::.| |....
  Fly   637 FVHVLK------QNQQKAVQKHT--ELVEQYRHFNGTKL---LCLNS-GLSAVPQNIFQ-LPSAR 688

  Fly   770 NPHVDCQDL 778
            |..|.|:|:
  Fly   689 NQMVSCEDV 697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 167/586 (28%)
peroxinectin_like 364..750 CDD:188655 122/415 (29%)
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 164/570 (29%)
An_peroxidase_like 290..637 CDD:265428 110/370 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2019
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11475
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.