DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and CG10211

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001286043.1 Gene:CG10211 FlyBaseID:FBgn0032685 Length:1394 Species:Drosophila melanogaster

Alignment Length:737 Identity:256/738 (35%)
Similarity:370/738 (50%) Gaps:81/738 (11%)


  Fly   100 PDEPAAEWA-LQQAALGHHDGAQAVSAGIKALGDREILEEGLQPNEVNTPSFRHYRSLSTNPEAR 163
            ||..||.:: ...|||.     .|.|:.|..|...||::   ..|.:.    |..|.: .||...
  Fly   625 PDGTAASFSKANLAALN-----LANSSLIFELTSNEIVK---TLNHIT----RRKRQI-FNPNQN 676

  Fly   164 KLARRGYVENQATIDIAKRFNYTKQPGRSNIGWGPKIV--LPDPTVLRLECDFNARYRRSTGVCN 226
            ...|....:...|:||:           ..:|...|.:  .|:|:   .:||.|:.:|..:|.||
  Fly   677 AFNRNELTDTLQTVDIS-----------GLLGGAQKQLDTCPEPS---QQCDANSPFRTLSGRCN 727

  Fly   227 NKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHG----RLPPARQVSLKIHRSSYETDSNFTV 287
            |.::| .:|.|:..:.|::...|.|||:|||::  |    .||..|.:|..||.......:.:::
  Fly   728 NLRNP-NWGKSLTTFSRLLPAQYEDGISAPRLT--GVTGTALPNPRTISTTIHPDISNLHTRYSL 789

  Fly   288 MLAVFGQFMDHDITATSLTTSQEG--ESIDCCVAATREQ--HPECYPVDILPDDPYYKQYNIS-- 346
            |:..|.||:|||:|   ||...:|  |||..|......|  ||||.|..:...|.||.:.|::  
  Fly   790 MVMQFAQFVDHDLT---LTPIHKGFHESIPSCRPCNSRQTVHPECNPFPVPAGDFYYPEVNVTSG 851

  Fly   347 ---CMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTD-DGR 407
               |...:||.|.... .|||.|:||.|.|:|.|:|||......|:||.|   |.||..|. .|:
  Fly   852 ERFCFPSMRSLPGQQS-LGPRDQINQNTHFLDGSMVYGETTCLSNKLRGF---SGRMNSTQVRGK 912

  Fly   408 QLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWE 472
            :|||:..:|.  |.    :|.| .||..|||||:|...||::|..:.|.||.:...|:..||||.
  Fly   913 ELLPLGPHPE--CK----SRNG-LCFLGGDDRASEQPGLTAIHTAFLREHNRIVEGLRGVNPHWN 970

  Fly   473 DERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKG--LLPAKHNLNAPDTYDPEVDPSIANC 535
            .|:|:..||||:.||:.||.:|||||.:|..|.....|  |||..:..:    |:|...|.:.|.
  Fly   971 GEQLFHHARKIVSAQVQHIVFNEFLPRILSWNAVNLYGLKLLPQGYYKD----YNPSCSPIVFNE 1031

  Fly   536 FAAAAFRFAHTLL-PGLFNISRDNSTPE-AIELHKMLFNPFSLWAEHGIDHALMTAANTPVMQVD 598
            |||||||..|:|| |.:..:|..:...| .:.|....|...:|.....||..|.....||:..:|
  Fly  1032 FAAAAFRIGHSLLRPHIPRLSVQHQPVEPPLLLRDGFFRMDALLQPGIIDEILRGLVATPMETLD 1096

  Fly   599 RFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAI 663
            :|.:.|||..|||   :.::|..|:||::|||||.||||||||..:|..|.|.....|.::|:.|
  Fly  1097 QFITGEVTNHLFE---DRKIPFSGIDLIALNIQRARDHGIPSYNNYRALCNLKRATNWNDLSREI 1158

  Fly   664 DNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQ 728
            ....::..::||.|..|:|::.||::|.||.|.:.||.|:|::..||.:|:..|..|||.:....
  Fly  1159 PTEVINRFQKIYASVDDIDLFPGAMTERPLQGGLVGPTLACIIGIQFRQLRKCDRFWYENQNPEV 1223

  Fly   729 KFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSEKQQ 793
            |||:|||||:.|.:||.|:|.|.:....::........:..||.|.|..:.....|  .|.|..|
  Fly  1224 KFTEAQLAEVRKVTLAKIVCENLEITGDMQRAAFDLPSNFLNPRVPCASMPQIDLN--AWRENVQ 1286

  Fly   794 PQDLHSAGISRGSTSVRVMSKA 815
                   |...|:.:|||...|
  Fly  1287 -------GCQIGNRNVRVGESA 1301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 213/555 (38%)
peroxinectin_like 364..750 CDD:188655 158/391 (40%)
CG10211NP_001286043.1 An_peroxidase 69..524 CDD:281139
An_peroxidase_like 209..524 CDD:265428
An_peroxidase 719..1245 CDD:281139 212/550 (39%)
peroxinectin_like 871..1245 CDD:188655 158/391 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11475
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.