DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and Lpo

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_006247147.1 Gene:Lpo RGDID:1310051 Length:710 Species:Rattus norvegicus

Alignment Length:736 Identity:228/737 (31%)
Similarity:349/737 (47%) Gaps:93/737 (13%)


  Fly   109 LQQAALGHHD-GAQAV-----SAGIKALGDREILEEGLQPNEVNTPSFRHYRSLS-----TNPEA 162
            ||.||...:| .|:.|     ...:||..::..|:...:..:..:...|..|.||     .....
  Rat    17 LQTAASARNDPPAKTVIICDTVEEVKASVNKAFLDSRSRLKKAMSAEVRSTRHLSDYLKHAKGRT 81

  Fly   163 RKLARRGYVENQATIDIAKRFNYTKQPGRS--------NIGWGPKIVLPDPTVLRLECDFNARYR 219
            |...|.|.|..::...:.:..  |...|:.        .:|..|    |.|.|   .|:.:..||
  Rat    82 RTAIRNGQVWEESLKKLTQFL--TNATGQGLDLTSLFWKVGCNP----PAPAV---TCNISNPYR 137

  Fly   220 RSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAP------RVSHHGRLPPARQVSLKIHRSS 278
            ..||.|||:::| ..|::.....|.:..:|.||::.|      :..:...||..|:||.:|....
  Rat   138 TITGDCNNRKNP-ALGSANRALARWLPAEYEDGLSLPFGWTPGKTRNGYPLPQPREVSNQIAGYL 201

  Fly   279 YE---TDSNFTVMLAVFGQFMDHDI-----TATSLTTSQEGESIDCCVAATREQHPECYPVDILP 335
            .|   .|...:|:...:||.:|||:     |........:.:..:.|:     |...|:|:....
  Rat   202 NEEDVLDQKRSVLFMQWGQIVDHDLDFAPDTEMGTDNYTKAQCDEHCI-----QGDNCFPIMFPT 261

  Fly   336 DDPYYKQYNISCMNFVRS---APAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGS 397
            .||..|... .||:|.|:   .|.|..:...|.|:|..|:|:|||:||.......|:||: ::..
  Rat   262 GDPKLKTQG-KCMSFFRAGFVCPTPPYQSLTREQINALTSFLDASLVYSPEPSMANRLRN-LSSP 324

  Fly   398 LRMF-----VTDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHH 457
            |.:.     |:|.||...|........|..:..| .|..||.:||.||:|.:||.:.|.|:.|.|
  Rat   325 LGLMAVNEEVSDHGRPFPPFVKMKPSPCEVINAT-AGVPCFLAGDSRASEQILLATSHTLFIREH 388

  Fly   458 NYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPD 522
            |.|||:|...||||:.|.||||.|||:||.:..||:.::||:|||   .|.:..:|....     
  Rat   389 NRLARELSTLNPHWDGETLYQETRKIMGAFIQIITFRDYLPILLG---DEMQKWIPPYQG----- 445

  Fly   523 TYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDN-----STPEAIELHKMLFNPFSLWAEHGI 582
             |:..|||.|:|.| ..||||.|..:|...:...:|     |.|| :.||.:.||.:.|..:.||
  Rat   446 -YNESVDPRISNVF-TFAFRFGHLEIPSTVSRLDENYQPWGSEPE-LPLHTVFFNTWRLVKDGGI 507

  Fly   583 DHAL--MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFR 645
            |..:  :.|....:|..||..:.|:..|||:.|.    .:.|.||.|:||||.||||:|.|..:|
  Rat   508 DPLVRGLLAKKAKLMHQDRMMTGELRNKLFQPTH----TIHGFDLASINIQRCRDHGMPGYNSWR 568

  Fly   646 RHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQ 709
            ..|.|....|.||:|..::|..| ..:..:|.:|.::|::.||::||.:.|...||||:|::..|
  Rat   569 AFCGLSQPKTLEELSAVMENEVLAKKLLDLYGTPSNIDIWLGAIAEPLVPGGRVGPLLTCLLGHQ 633

  Fly   710 FLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPH-- 772
            |.|::.||..|:|   .|..||:.|...:.|.|.:.::|.|: |||:|   .:........||  
  Rat   634 FQRVRDGDRFWWE---NPGVFTEKQRESLQKLSFSRLVCDNT-GITKV---PLNPFLANTYPHGF 691

  Fly   773 VDCQDLEGFHFNFEPWSEKQQ 793
            |||..::  ..:..||:..|:
  Rat   692 VDCSSVD--KLDLSPWAAVQK 710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 192/567 (34%)
peroxinectin_like 364..750 CDD:188655 147/399 (37%)
LpoXP_006247147.1 An_peroxidase 136..675 CDD:281139 192/567 (34%)
myeloperoxidase_like 281..692 CDD:188656 156/435 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 310 1.000 Inparanoid score I2478
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.