DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and ptgs1

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_705942.1 Gene:ptgs1 ZFINID:ZDB-GENE-020530-1 Length:597 Species:Danio rerio

Alignment Length:595 Identity:113/596 (19%)
Similarity:201/596 (34%) Gaps:198/596 (33%)


  Fly   233 TYGASMVPYRRMVSP-------DYADGIAAPRVSHHGR-LPPARQ-------------------- 269
            |..|:::|     ||       ||.:..|...::::.| |||...                    
Zfish   118 TVRANLIP-----SPPTYNSRYDYLNWEAYSNITYYTRILPPVPNDCPTPMGTKGKIKLPDPKLL 177

  Fly   270 VSLKIHRSSYETDSNFT-VMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYPVDI 333
            |...:.|.::..|...| :|.|.|.|...|.                                  
Zfish   178 VEKFMLRRNFRLDPQGTNLMFAFFAQHFTHQ---------------------------------- 208

  Fly   334 LPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSL 398
                 ::|.:|...:.|.:.             |...   :||..:||:...||.:||...:|.|
Zfish   209 -----FFKTHNRVGLGFTKG-------------LGHG---VDAGHIYGDSLDRQLELRLHKDGKL 252

  Fly   399 RMFVTDDG-----------RQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHL- 451
            :..|.:..           :...|.|..|.      |...:|:..|.          ||..:.: 
Zfish   253 KYQVLNGDIYPPTVLHAQVKMSYPPSVPPE------QQLAIGQEVFG----------LLPGLGMY 301

  Fly   452 --LWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPA 514
              ||.|.||.:...|::::|.|.||:|:|.||.|:..:...|...|::..|.|..:.        
Zfish   302 ATLWLREHNRVCEILKQEHPTWGDEQLFQTARLIIIGETIRIVIEEYVQHLSGYRLK-------- 358

  Fly   515 KHNLNAPDTYDPEVDPSIANCFAAAAFRFA-------------HTLLPGLFNISRDNSTPEAIEL 566
            .|       :||.:   :.|    :.|::.             |.|:|..|.|..|:     |:.
Zfish   359 LH-------FDPTL---LFN----SQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDH-----IQY 404

  Fly   567 HKMLFNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQ 631
            .|.:||. |:...:|::..:...:..|..|:....::   ..:..|.|| ||           |.
Zfish   405 SKFIFNT-SILTHYGLEKLVEAFSIQPAGQIGGGHNI---HPVVSGVAE-RV-----------IV 453

  Fly   632 RGRDHGIPSYPVFRRHCRLPTVDTW------EEMSQAIDNATLDSIRQIYESPQDVDVYTGALSE 690
            ..|:..:..:..:|:...|....::      :|||:.::        ::|.....::.|...|.|
Zfish   454 ESRELRLQPFNEYRKRFNLKPYTSFAELTGEQEMSKELE--------ELYGHIDAMEFYPALLLE 510

  Fly   691 PPLDGAIFGPLLSCMVSDQFLRLKLGD-----SHWYERKMGPQKFTKAQLAEIYKTSLAAIICRN 750
            ....||:||..:..|.:...|:..:|:     .:|.....|    .|.....:...:|..::|.|
Zfish   511 KTRPGAVFGESMVEMGAPFSLKGLMGNPICSPDYWKPSTFG----GKTGFDIVNSATLKKLVCLN 571

  Fly   751 SDGITRVREH 760
            :.....|..|
Zfish   572 TKWCPYVSFH 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 111/589 (19%)
peroxinectin_like 364..750 CDD:188655 86/424 (20%)
ptgs1NP_705942.1 EGF 36..68 CDD:278437
prostaglandin_endoperoxide_synthase 90..576 CDD:188648 111/589 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.