| Sequence 1: | NP_651081.1 | Gene: | cd / 42681 | FlyBaseID: | FBgn0263986 | Length: | 830 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_505188.3 | Gene: | pxn-1 / 191484 | WormBaseID: | WBGene00004256 | Length: | 1285 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 908 | Identity: | 263/908 - (28%) | 
|---|---|---|---|
| Similarity: | 389/908 - (42%) | Gaps: | 237/908 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    21 LPP--YQGPERVFPGGVSPRARRNKMRQFQCCMGITFIAIVFTALCLALVFSDSLGGADGGPSFF 83 
  Fly    84 FV--VNGSDSELAPNRPLPDEPAAEWALQQAALGHHDGAQAVSAGIKALGDREILEEG--LQPNE 144 
  Fly   145 VNTPSFRHYRSLSTNP---------------EARKLA---------------RRGYVENQA---- 175 
  Fly   176 ----------TIDIAK--RFNYTKQP----------------GRSNIGWG---------PKIVLP 203 
  Fly   204 DPTVLRL----------------------ECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVS 246 
  Fly   247 PDYADGIAAPRVSHHGR------LPPARQVSLKIHRSSYET-DSNFTVMLAVFGQFMDHDITATS 304 
  Fly   305 LTTSQEGESIDCCVAATREQHPECYPVDILPDDPYYKQYNIS--CMNFVRSAPAPTG-------- 359 
  Fly   360 -RFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFI--NGSLRMFVTDD-GRQLLPISSNPADGC 420 
  Fly   421 NRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILG 485 
  Fly   486 AQMAHITYNEFLPVLLG------KNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFA 544 
  Fly   545 HTLL-PGLFNISRDNSTPEA--IELHKMLFNPFSLWAEHGIDHALMTAANTPVM--QVDRFFSLE 604 
  Fly   605 VTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAI-DNATL 668 
  Fly   669 DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKA 733 
  Fly   734 QLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVD------CQDLEGFHFNFEPWSE 790 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| cd | NP_651081.1 | An_peroxidase | 218..755 | CDD:281139 | 200/569 (35%) | 
| peroxinectin_like | 364..750 | CDD:188655 | 146/400 (37%) | ||
| pxn-1 | NP_505188.3 | LRRNT | 23..51 | CDD:279764 | |
| leucine-rich repeat | 35..53 | CDD:275380 | |||
| LRR_8 | 52..112 | CDD:290566 | |||
| LRR_4 | 53..93 | CDD:289563 | |||
| leucine-rich repeat | 54..77 | CDD:275380 | |||
| LRR_4 | 77..120 | CDD:289563 | |||
| leucine-rich repeat | 78..101 | CDD:275380 | |||
| leucine-rich repeat | 102..117 | CDD:275380 | |||
| LRR_8 | 123..182 | CDD:290566 | |||
| leucine-rich repeat | 125..148 | CDD:275380 | |||
| leucine-rich repeat | 149..172 | CDD:275380 | |||
| I-set | 315..400 | CDD:254352 | |||
| IGc2 | 328..392 | CDD:197706 | |||
| IG_like | 414..496 | CDD:214653 | 25/148 (17%) | ||
| Ig | 420..496 | CDD:299845 | 22/103 (21%) | ||
| An_peroxidase | 634..1181 | CDD:281139 | 200/569 (35%) | ||
| peroxidasin_like | 757..1203 | CDD:188658 | 166/473 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2408 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D276568at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||