DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and pxn-1

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_505188.3 Gene:pxn-1 WormBaseID:WBGene00004256 Length:1285 Species:Caenorhabditis elegans

Alignment Length:908 Identity:263/909 (29%)
Similarity:389/909 (43%) Gaps:237/909 (26%)


  Fly    21 LPP--YQGPERVFPGGVSPRARRNKMRQFQCCMGITFIAIVFTALCLALVFSDSLGGADGGPSFF 83
            :||  |:||:.|                                       |.:|||     |..
 Worm   406 VPPNIYEGPQSV---------------------------------------SQNLGG-----SVV 426

  Fly    84 FV--VNGSDSELAPNRPLPDEPAAEWALQQAALGHHDGAQAVSAGIKALGDREILEEG--LQPNE 144
            ||  .||:        |:||   ..|:...:.:||..|...||            ::|  |:.:.
 Worm   427 FVCKANGN--------PVPD---YTWSFDGSTIGHIKGRFMVS------------DDGTELRISN 468

  Fly   145 VNTPSFRHYRSLSTNP---------------EARKLA---------------RRGYVENQA---- 175
            :......:|..::.||               |.||.|               .|..|||..    
 Worm   469 IEKKDEGYYSCMAGNPVGAMSADAKLTVIGGETRKAAAPQIDEELLRAIAQKARQNVENAVEKTR 533

  Fly   176 ----------TIDIAK--RFNYTKQP----------------GRSNIGWG---------PKIVLP 203
                      |.|:.:  ||:..||.                .|.::..|         ||.|..
 Worm   534 KQLTQDKVTNTNDLKRLFRFSTPKQAVELSKAREIYEESVRLVREHVEKGLILNVDELHPKNVSY 598

  Fly   204 DPTVLRL----------------------ECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVS 246
            : :||.:                      :..|:.|||...|.||||..|.| |.|::|.||::.
 Worm   599 E-SVLHVTHVQALMGLSGCHTGQYKNPCTDTCFHHRYRSFDGQCNNKNKPMT-GVSLMPLRRLLK 661

  Fly   247 PDYADGIAAPRVSHHGR------LPPARQVSLKIHRSSYET-DSNFTVMLAVFGQFMDHDITATS 304
            |.|.:|...|.....||      ||..|:||.::..:...| .|..:.|:..:|||:|||:|.|.
 Worm   662 PVYENGFNTPVGWEKGRLYNGYPLPNVREVSRQLVATENITPHSKLSSMVMQWGQFVDHDLTHTV 726

  Fly   305 LTTSQEGESIDCCVAATREQHPECYPVDILPDDPYYKQYNIS--CMNFVRSAPAPTG-------- 359
            ...|:...:.......|.|....|:.:.:.|:||..|..:..  |:.|.||| |..|        
 Worm   727 TALSRHSYATGAFCNRTCENLDPCFNIPLSPNDPRVKSGSAKYPCIEFERSA-AVCGSGETSLVF 790

  Fly   360 -RFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFI--NGSLRMFVTDD-GRQLLPISSNPADGC 420
             |...|.|:|..|:|:|||.|||:.|.:..:||...  ||.||..:|.: |::.||...:....|
 Worm   791 NRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGMLRFDITSEAGKEYLPFEKDSNMDC 855

  Fly   421 NRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILG 485
            .|.........||.:||.||||.|.|.:.|.::.|.||.:|::|:..|.:|:.|.:|.|.|||:|
 Worm   856 RRNFSEENPIRCFLAGDLRANEQLALAATHTIFIREHNRIAKKLKSMNGNWDGEIIYHETRKIVG 920

  Fly   486 AQMAHITYNEFLPVLLG------KNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFA 544
            |.|.||||..::|::.|      |.:...:|             |||:||.|:.|.||.|||||.
 Worm   921 AMMQHITYKHWMPIIFGGQAQMNKFVGTYQG-------------YDPDVDASVTNAFATAAFRFG 972

  Fly   545 HTLL-PGLFNISRDNSTPEA--IELHKMLFNPFSLWAEHGIDHALMTAANTPVM--QVDRFFSLE 604
            ||:: |.||.:..|....:.  |.|||..|.|..:..:.|:|..|.....:|:.  ...:..::|
 Worm   973 HTIINPSLFRLGNDFMPIKEGHIALHKAFFTPELVLTQGGVDPLLRGLFASPLKHPMPTQLLNME 1037

  Fly   605 VTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAI-DNATL 668
            :.:|||....|     ..|||..:||||.||||:|||..:|:.|.||....||:|...| |:..:
 Worm  1038 LIEKLFMKGHE-----VSLDLAVMNIQRSRDHGLPSYTEYRKFCNLPVPVQWEDMKGYIKDDMII 1097

  Fly   669 DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKA 733
            ..:|.:|..||::|::.|.:.|..|:..:|||..:|::.:||.:::.||..|||:   ...||..
 Worm  1098 QKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKIRDGDRFWYEK---DGVFTPE 1159

  Fly   734 QLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVD------CQDLEGFHFNFEPWSE 790
            ||.||.|.:||.:.|.|.|.|.|:::.|..      .|.:|      ||:.|  ..|...||:
 Worm  1160 QLREIKKITLARLFCDNGDNIDRIQKDVFM------YPGMDKENYGTCQETE--MMNLRAWSK 1214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 201/570 (35%)
peroxinectin_like 364..750 CDD:188655 146/401 (36%)
pxn-1NP_505188.3 LRRNT 23..51 CDD:279764
leucine-rich repeat 35..53 CDD:275380
LRR_8 52..112 CDD:290566
LRR_4 53..93 CDD:289563
leucine-rich repeat 54..77 CDD:275380
LRR_4 77..120 CDD:289563
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..117 CDD:275380
LRR_8 123..182 CDD:290566
leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 149..172 CDD:275380
I-set 315..400 CDD:254352
IGc2 328..392 CDD:197706
IG_like 414..496 CDD:214653 25/149 (17%)
Ig 420..496 CDD:299845 22/104 (21%)
An_peroxidase 634..1181 CDD:281139 201/570 (35%)
peroxidasin_like 757..1203 CDD:188658 167/474 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.