DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and R08F11.7

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_504048.1 Gene:R08F11.7 WormBaseID:WBGene00019970 Length:773 Species:Caenorhabditis elegans

Alignment Length:782 Identity:227/783 (29%)
Similarity:349/783 (45%) Gaps:134/783 (17%)


  Fly    81 SFFFVVNGSDSELAPNRPLPDEPA-AEWALQQAALGHHDGAQAVSAG----------IKALGDRE 134
            :.|..:|..||..:      .||: |:.|:..:.:.:.:..|....|          :|..| .:
 Worm    33 ALFEALNTVDSSFS------SEPSVADGAIVSSQIANAESKQLQFTGDVLEIATQILVKKYG-VD 90

  Fly   135 ILEEGLQPNEVNT------PSFRHYRSLSTNPEARKLARRGYVEN-------------------- 173
            |||:.   |||.|      .|.|..||:.      ::.:..:|.|                    
 Worm    91 ILEDA---NEVLTELNAGESSARKKRSVD------EVEQESFVANLRQKRQSRGKRQGGGGGGRG 146

  Fly   174 ------------QATIDIAKRFNYTKQ----------PGRSNIG-WGPKIVLPDPTVLRLECDFN 215
                        ....|..|:.|..:|          |.:||.. .||.....||.        :
 Worm   147 GGGGGRGGDGGRSGEQDGRKKRNSGEQQGGGGRTEYSPPKSNATCQGPPKSCSDPV--------H 203

  Fly   216 ARYRRSTGVCNNKQHPRTYGASMVPYRRMV-SPDYADGIAAPR-VSHHGR-LPPARQVSLKIHRS 277
            .|.|..||.|||:..| |...|:...||:: :..|.||:.|.| .|..|. ||..|.:|.|:|..
 Worm   204 DRIRSITGYCNNRGKP-TQANSVTAIRRLLGTTSYTDGLQAIRNTSVTGSPLPSTRLISNKLHDE 267

  Fly   278 SYETDSNFTVML----AVFGQFMDHDITATSLTTSQEGESIDC--CVAATREQHPECYPVDILPD 336
            .  :..||:..:    ...|||:.|||.....:|:::|.|::|  |.:.|... ..|.|:....|
 Worm   268 G--STPNFSPSVNHLHMQIGQFIAHDIIFMPSSTAKDGSSLNCTSCSSPTTIS-TNCAPIPAPAD 329

  Fly   337 DPYY---KQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSL 398
            |.|:   .:....|:...|:....:| ||.|.|::|.:.::|.|.|||:.:.....:|||.||  
 Worm   330 DKYFTPVSRTEARCIRLTRALNGQSG-FGVRTQIDQNSHYLDMSAVYGSSDCEARTVRSFQNG-- 391

  Fly   399 RMFVTDDG-RQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLL---LTSMHLLWARHHNY 459
             :.:|:.| ..:||..:.....|   |.|. ..|||.:||.|   |.|   |..:|:::.:.||.
 Worm   392 -LLLTNTGIGYVLPPQAPNDTNC---QSTN-PYYCFTAGDFR---NCLHPGLLPLHIVFIKEHNR 448

  Fly   460 LARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTY 524
            ||.:::...|.|.||::||..|||:.||...|.|||:||.||.........|.|.|........|
 Worm   449 LAVKVKAAQPSWNDEQIYQFVRKIMVAQWQQIVYNEYLPKLLTDKYLTDFNLKPMKPGAGPFQGY 513

  Fly   525 DPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKMLFNPFSLWAEH-------GI 582
            ...::.:::..||||||||.|:  ....:.:|.::|.:.|..:.:..|.|  :|:.       |.
 Worm   514 STSMNAALSGEFAAAAFRFGHS--QSRQDFARQDATNKTIGAYDLGNNIF--YADQVYQKSLGGS 574

  Fly   583 DHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRH 647
            :..|:....|..|||||:||..:..:|||...::.   .|:||:|:||.||||.|:..|..:|..
 Worm   575 ETMLLGLIKTAGMQVDRYFSFPIRNQLFEIRGKNG---SGVDLISVNIMRGRDVGLMPYVKYRTL 636

  Fly   648 CRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLR 712
            ..|..||||.::|.....|.|.:::.:|..|.|:|:|||.:.|.||.|...||..|.::::||..
 Worm   637 VGLSPVDTWNDLSSTFTAANLAALKTVYADPADIDLYTGLVMETPLAGGQLGPTASWIIAEQFRA 701

  Fly   713 LKLGDSHWYERKM-GPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQ 776
            ||.||..:||..: ....||..|:..|.:..||.|.|.|:..||.:...:.    |..:..|.|.
 Worm   702 LKTGDRFYYENGVANTVGFTPTQIDAIRRVKLAKIFCENTAIITSINTDIF----DLNSSQVACS 762

  Fly   777 DL 778
            .:
 Worm   763 SI 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 186/561 (33%)
peroxinectin_like 364..750 CDD:188655 136/398 (34%)
R08F11.7NP_504048.1 An_peroxidase 207..745 CDD:281139 186/560 (33%)
peroxinectin_like 359..740 CDD:188655 136/398 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.