DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and K10B4.1

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_493669.2 Gene:K10B4.1 WormBaseID:WBGene00019613 Length:1294 Species:Caenorhabditis elegans

Alignment Length:751 Identity:235/752 (31%)
Similarity:362/752 (48%) Gaps:123/752 (16%)


  Fly    94 APNRPLPDEPAAEWALQQAALGHHDGAQAVSAGIKALGDREILEEGLQPNEVNTPSFRHYRSLST 158
            |.||..|.      .||:   |.|:.....|.|...|...|.:      ||.|.       ||..
 Worm   572 ARNRQRPA------TLQE---GLHNSVALKSYGSMMLAKDEAV------NEANV-------SLIL 614

  Fly   159 NPEARKLARRGYVENQATIDIAKRFNYTKQPG-RSNIGWGPKIVLPDPTVLRLECDFNARYRRST 222
            ....:||.:..::|    :|..:..|..:..| :|:....||         .|.||....||..|
 Worm   615 LEATKKLVKLKHIE----LDSIQSVNIGEDFGKKSDSQCNPK---------NLPCDSTNPYRSYT 666

  Fly   223 GVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPR--VSHHGRLPPARQVSLKIHRSSYETDSNF 285
            |.|||.:.| :...:....||::.|.|.|||..||  .....|||..|.:|..:|.:.......:
 Worm   667 GWCNNLETP-SLANTFRELRRLLPPAYEDGIDLPRSKTITGSRLPSPRVISNMVHHAKKIEHVKY 730

  Fly   286 TVMLAVFGQFMDHDITATSLTTSQEGESIDC--CVAATREQHPECYPVDILPDDPYYKQYNISCM 348
            :..:..||||:|||||.:.:..:.:|.:::|  |.:. |...|.|:|:.:..:|.:::.:  ||:
 Worm   731 SHFVMEFGQFIDHDITHSPVDQNSDGTALNCSRCDSG-RFVSPSCFPIPVPVNDVHFEPF--SCL 792

  Fly   349 NFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTDD-----GRQ 408
            :||||.||.. ..|.|.|:||.:|::|.||:||:.:...::||:|.:|.::...|..     |..
 Worm   793 SFVRSLPAQK-TLGYRNQMNQVSAYLDGSVMYGSTKCEGDRLRTFQDGKMKTTQTSRAPRHYGIT 856

  Fly   409 LLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWED 473
            |.....:..|||    ::.....||.:||||.::..||.::|.::.|.|..:...|:|.||:|:|
 Worm   857 LSQSDESEQDGC----VSAPDAPCFIAGDDRNSQQTLLIAVHSVFHREHERITTTLKEINPNWDD 917

  Fly   474 ERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAA 538
            |::|||.||::.|:.|||.|||:||:::|:.:.:...|.|.:....  |.|: ..|.||...||.
 Worm   918 EKIYQETRKLISAEFAHIVYNEYLPIIIGQKLIDDYDLRPRQDGYY--DGYE-NCDASILQPFAT 979

  Fly   539 AAFRFAHT---------------------LLPGLFNISR--DNSTPEAIELHKMLFNPFSLWAEH 580
            |||||.|:                     |.....|:|:  ||...|.|           |...|
 Worm   980 AAFRFGHSTVTRFTPMQETVHDPATCVVDLASDFLNMSKIYDNEAVEQI-----------LGGMH 1033

  Fly   581 GIDHALMTAANTPVMQVDRFFSLEVTQKLF-----EGTAEDRVPLCGLDLVSLNIQRGRDHGIPS 640
            | .|.:||         |||....:...||     .||        ||||:|:|||||||||||.
 Worm  1034 G-KHQMMT---------DRFVDDAIRNFLFSDRGRRGT--------GLDLISINIQRGRDHGIPP 1080

  Fly   641 YPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCM 705
            |..:|..|.|..:.::..:...|:...|.:|.::||||.|:|::||.:||..:.|.|.||..:|:
 Worm  1081 YNHYRSFCGLSRLTSFYSIFSDINQDGLTAIGKVYESPDDIDLFTGIVSEKTIPGGIVGPTAACI 1145

  Fly   706 VSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGN 770
            :::||.|||..|..:||......||:.:||.|:.|||::|:||.|:. :.::.:.|........|
 Worm  1146 IAEQFRRLKKCDRFYYENGEDHSKFSASQLKEVRKTSMSALICANTK-VPKISKDVFSVPDPFSN 1209

  Fly   771 PHVDCQDLEGFHFNFEPWSE------KQQPQDLHSA 800
            |.::| ||.. ..:...|.:      |.:...|||:
 Worm  1210 PLINC-DLYP-KLDLSKWRDAKDCIYKGKTIQLHSS 1243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 195/574 (34%)
peroxinectin_like 364..750 CDD:188655 145/419 (35%)
K10B4.1NP_493669.2 An_peroxidase 93..509 CDD:281139
An_peroxidase_like 94..>321 CDD:265428
An_peroxidase_like 224..508 CDD:265428
An_peroxidase 662..1191 CDD:281139 195/570 (34%)
peroxinectin_like 807..1190 CDD:188655 145/419 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.