DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and hpx-2

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_506432.1 Gene:hpx-2 WormBaseID:WBGene00008627 Length:718 Species:Caenorhabditis elegans

Alignment Length:733 Identity:218/734 (30%)
Similarity:343/734 (47%) Gaps:97/734 (13%)


  Fly    85 VVNGSDSELAPNRPLPDEPAAEWAL--QQAALGHHDGAQAVSAGIKALGDREILEEGLQPNEVNT 147
            |:...||..:.|.  ..|..::..:  |||   :.|...|...|       |:|||.   ..:..
 Worm    34 VMRALDSRASENS--ESEQTSQHIIVSQQA---NSDSKSAQFTG-------EVLEEA---TRILV 83

  Fly   148 PSFRHYRSLSTNPEARKLARRGYVENQATIDIAKRFNYTKQPGRSNIGWGPKIVLPDPT------ 206
            ..|    .|...|.|.::..|...|.:..:..::....|:.              ||||      
 Worm    84 REF----GLEILPAANEVIERWRNEEEELLQSSETTTTTEH--------------PDPTRSKRSA 130

  Fly   207 VLR-------------LECD--FNARYRRSTGVCNNKQHPRTYGASMVPYRRMV-SPDYADGIAA 255
            :.|             :.|:  |:...|..||:|||:|: ...|.|:.|.||:: :..||||:..
 Worm   131 IFRSKRQANRRCSSPPINCNNRFHTSIRSITGLCNNRQN-SDLGNSVSPLRRILGAASYADGLGR 194

  Fly   256 PRVS--HHGRLPPARQVSLKIH--RSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDC 316
            .|..  :.|.||.||.:|.:||  |::.....:...:..:.|||:.||:.....:.:::|.::||
 Worm   195 IRTRSVNGGELPSARLISNRIHDDRNNQVFSPSINHLHMIIGQFIAHDVVFMPSSVARDGGALDC 259

  Fly   317 CVAATREQ-HPECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGR--FGPRMQLNQATAFIDASV 378
            ....:.:: .|.|.|:.|..:|||   :|..||...|   |..|:  ||.|.|:.|.:.|:|.|.
 Worm   260 SACNSPQRVSPNCAPITIPRNDPY---FNTPCMRLTR---ALNGQENFGVRSQIGQNSHFLDLSP 318

  Fly   379 VYGNLEQRQNQLRSFINGSLRMFVTDD-GRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANE 442
            |||:.:.....:|||..|  :|...|| |..|.|.::|.:: |    .:....:||..||.|.:.
 Worm   319 VYGSADCEAETVRSFQEG--KMLTFDDLGYTLPPQNANDSN-C----QSSAPFHCFTCGDFRNSL 376

  Fly   443 NLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISE 507
            :..|..:|.:..:.||.||.|::...|.:.||:::|..|||:.....||.|||::|..|.:....
 Worm   377 HPALIPVHTILIKEHNRLAEQVRVARPRFNDEQIFQLVRKIMIGMWQHIVYNEYIPKYLPRRTIR 441

  Fly   508 AKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISR--DNSTPEA-IELHKM 569
            ...|.|.::.::.  .|...|||||:..||.|||||.|:  ...|:..|  :|..|.. .:|...
 Worm   442 NFALRPLRNGVHR--GYSTSVDPSISAEFAGAAFRFGHS--QSRFDFPRLTENGRPAGNYDLGND 502

  Fly   570 LFNPFSLWAEH--GIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQR 632
            :|....::...  |.:..:......|.|:.||:||..:..::||....:.   .|:||||:||||
 Worm   503 IFYADQMYLTRIGGWEPVMNGMVRMPAMKSDRYFSFGIRNQMFEIRGRNG---SGVDLVSINIQR 564

  Fly   633 GRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAI 697
            |||.|:..|..:|:...||||.::.|::.......:.::|.:|..|.|:|:|.|.:.|.||.|..
 Worm   565 GRDMGLFPYIQYRQLVGLPTVTSFNELNTTFSQENIQALRNVYSDPADIDLYVGIMLEEPLSGGQ 629

  Fly   698 FGPLLSCMVSDQFLRLKLGDSHWYER-KMGPQKFTKAQLAEI-YKTSLAAIICRNSDGITRVREH 760
            .||..|.|:.:||..||.||..:||. ..|...||:.:::|: .|||||.|||.|.|...|:...
 Worm   630 LGPTASFMIGEQFRALKRGDRFFYESIAEGTDNFTQEEISELRNKTSLAKIICTNMDFAARINTD 694

  Fly   761 VMQRLRDGGNPHVDCQDL 778
            :.    |..:..|.|..|
 Worm   695 IF----DHRSRQVACTSL 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 184/553 (33%)
peroxinectin_like 364..750 CDD:188655 133/394 (34%)
hpx-2NP_506432.1 An_peroxidase 158..686 CDD:281139 183/549 (33%)
peroxinectin_like 304..684 CDD:188655 133/394 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.