DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cd and hpx-2

DIOPT Version :10

Sequence 1:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_506432.1 Gene:hpx-2 / 179880 WormBaseID:WBGene00008627 Length:718 Species:Caenorhabditis elegans


Alignment Length:39 Identity:11/39 - (28%)
Similarity:16/39 - (41%) Gaps:1/39 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YQQYNDTTYTLKNVYDLLSNEFTDTFTTTTPDPRTSPTT 104
            :|:..|.:...:|......:|.|...|....|| |.|.|
 Worm    34 HQEVADNSCVYRNEVHHSVSERTQILTDVASDP-TLPRT 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..762 CDD:460804
hpx-2NP_506432.1 An_peroxidase 158..696 CDD:460804
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.