DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and C46A5.4

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_501272.2 Gene:C46A5.4 WormBaseID:WBGene00016700 Length:1537 Species:Caenorhabditis elegans

Alignment Length:910 Identity:266/911 (29%)
Similarity:414/911 (45%) Gaps:150/911 (16%)


  Fly    24 YQGPE--RVFPGGVSPRARRNKMRQFQCCMGITFIAIVFTALCLALVFSDSLGGADGGPSFF--- 83
            |:.||  .||.||:|.:..:..:      :|.||          |.:|:..:.....|..|:   
 Worm   637 YESPEDIDVFVGGLSEQPTKGSL------LGPTF----------ACLFAHQMAQTKRGDRFWYEN 685

  Fly    84 ------FVVNGSDS--ELAPNRPLPDEPAAEWALQQAALGHHDG-----AQAVSAGI------KA 129
                  |.|:..|.  :....|.:.|.......:|..|....|.     ....|.||      ||
 Worm   686 FVSPSAFTVDQIDEIRKTTMARIICDNTDTVTHVQHHAFSLPDDYGNCPLSCNSTGIIQVFDPKA 750

  Fly   130 LGDREIL------------------------EEG------LQPNEVNTPS--FRHYRSLSTNPEA 162
            ..|.|.|                        |||      .|.:: ::||  ..|...::...|:
 Worm   751 FKDEEKLTSLPITKETVEKVIRLGLRQWQRYEEGEGRRISAQLSD-SSPSALLSHALLMAPKKES 814

  Fly   163 RKLARRGYVENQAT-----------------------------IDIAKRF-NYTKQPGRSNIGWG 197
            ..:||...|..:||                             ||:.... |:|....|..:   
 Worm   815 IDIARTASVLREATNILISGNGLDKDERLPDLDIGTLQKILPQIDVGSVIGNFTPFLARDPL--- 876

  Fly   198 PK-IVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSH- 260
            || ..||:|    |.||..::||..:|.|||.::|: :|.:....||::.|.|.||...||... 
 Worm   877 PKEQCLPEP----LPCDHTSKYRTYSGWCNNLKNPK-FGNAFTQMRRLLDPAYDDGFDTPRTRSV 936

  Fly   261 -HGRLPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDC--CVAA-T 321
             ...||.||::|..:|..:.:....||.||..|||.:|||:..:.::...:...::|  |.:| |
 Worm   937 LGSELPSARKISNIVHSDAPKFHVKFTHMLMQFGQILDHDMMHSPISRGPKNTILNCSSCDSAQT 1001

  Fly   322 REQHPECYPVDILPDDPYYKQYNIS----CMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGN 382
            ...|  |:|:.|..:||::...:..    ||.|.||..|... .|.|.||||.|:|:|||.:||:
 Worm  1002 LSIH--CFPIKIEANDPFFPSKHSDGRPRCMPFARSLLAQVS-LGFRNQLNQLTSFLDASTIYGS 1063

  Fly   383 LEQRQNQLRSFINGSLRMFVTDDG--RQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLL 445
            .:...|:||.|.:|.|..  ||.|  ::.||..:...| |..|...| .:.||.:||:|:||...
 Worm  1064 TQCEANKLRLFSDGKLNF--TDLGFNKEALPQGNQERD-CRSVLQNR-QRRCFVAGDERSNEQPG 1124

  Fly   446 LTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKG 510
            ||::|.::.|.||.:||.|::.|..|.||:|:||:|:|..||:.||.|.|:|||:||....|..|
 Worm  1125 LTAIHNIFLREHNRIARYLKQINNFWSDEKLFQESRRINIAQLQHIIYKEWLPVVLGCQNMEKWG 1189

  Fly   511 LLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDN--STPEAIELHKMLFNP 573
            |:|  ......:.||.:.|.:|:...:.:||||.|:|:.|:|....||  :....:.|.:...||
 Worm  1190 LMP--QTAGYFEGYDDQCDATISQEMSTSAFRFGHSLIRGVFTRMNDNFQNMTNHVNLTETFSNP 1252

  Fly   574 FSLWAEHG--IDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDH 636
            ..::.::.  ::..||.......|..||.....|...||   |:...||.||||.::||||||||
 Worm  1253 SPVYDKNSGHMESILMGLIGANSMAFDRHIVTAVRNHLF---AKPGGPLTGLDLPAVNIQRGRDH 1314

  Fly   637 GIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPL 701
            |:..|..:|:||.|.....:.::...:::..:.::...|....|:|::.|.:||.|..|::.||.
 Worm  1315 GVQGYNAYRKHCGLRKASAFSDLRDVMNSEAVTALETAYAHVDDIDLFPGIMSESPTRGSLVGPT 1379

  Fly   702 LSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLR 766
            |:|::.:|..|||..|..:||......:||..||.||.|.||:.|||.||:....::.:|.....
 Worm  1380 LACLIGEQMQRLKKCDRFYYETSDSMVRFTPDQLVEIRKASLSRIICDNSEYAANIQPNVFLMPD 1444

  Fly   767 DGGNPHVDCQDLEGFHFNFEPWSEKQQPQDLHSAGISRGSTSVRV-------MSKANHQAHNVTL 824
            |..|..:.|.:|.....|  .|.|:.... :....::||.|. |:       .:....:.|::|:
 Worm  1445 DLTNSPMTCSELSEIDLN--KWVERDYCL-VDERVVNRGKTK-RITPCITCTCTLEGPECHSITI 1505

  Fly   825  824
             Worm  1506  1505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 195/552 (35%)
peroxinectin_like 364..750 CDD:188655 144/392 (37%)
C46A5.4NP_501272.2 An_peroxidase 182..717 CDD:281139 20/96 (21%)
peroxinectin_like 334..712 CDD:188655 20/91 (22%)
An_peroxidase 894..1429 CDD:281139 194/548 (35%)
peroxinectin_like 1045..1428 CDD:188655 144/392 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.