| Sequence 1: | NP_651081.1 | Gene: | cd / 42681 | FlyBaseID: | FBgn0263986 | Length: | 830 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_496407.1 | Gene: | T06D8.10 / 174717 | WormBaseID: | WBGene00011530 | Length: | 1490 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 695 | Identity: | 233/695 - (33%) | 
|---|---|---|---|
| Similarity: | 333/695 - (47%) | Gaps: | 57/695 - (8%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   118 DGAQAVSAGIKALGDREILEEGLQPNEVNTPSFRHYRSLSTNPEARKLARRGYVENQATIDIAKR 182 
  Fly   183 F-NYT---KQPGRSN-IGWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYR 242 
  Fly   243 RMVSPDYADGIAAPRV-SHHGR-LPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSL 305 
  Fly   306 TTSQEGESIDCCVAATREQHPE-----CYPVDILPDDPY----YKQYNISCMNFVRSAPAPTGRF 361 
  Fly   362 GPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTDDGRQLLPISSNPADGCNRVQMT 426 
  Fly   427 RLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHI 491 
  Fly   492 TYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLF---N 553 
  Fly   554 ISRDN-STPEAIELHKMLFNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDR 617 
  Fly   618 VPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVD 682 
  Fly   683 VYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAII 747 
  Fly   748 CRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSEKQ 792  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| cd | NP_651081.1 | An_peroxidase | 218..755 | CDD:281139 | 199/551 (36%) | 
| peroxinectin_like | 364..750 | CDD:188655 | 147/389 (38%) | ||
| T06D8.10 | NP_496407.1 | An_peroxidase | 160..668 | CDD:281139 | |
| peroxinectin_like | 308..665 | CDD:188655 | |||
| An_peroxidase | 847..1382 | CDD:281139 | 197/547 (36%) | ||
| peroxinectin_like | 998..1381 | CDD:188655 | 147/389 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2408 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D276568at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11475 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 5 | 4.880 | |||||