DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and T06D8.10

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_496407.1 Gene:T06D8.10 WormBaseID:WBGene00011530 Length:1490 Species:Caenorhabditis elegans

Alignment Length:695 Identity:233/696 (33%)
Similarity:333/696 (48%) Gaps:57/696 (8%)


  Fly   118 DGAQAVSAGIKALGDREILEEGLQPNEVNTPSFRHYRSLSTNPEARKLARRGYVENQATIDIAKR 182
            :||:.||. |.||    :||        .|........|.|:.:..||......:....||:...
 Worm   764 EGAKQVSQ-ISAL----LLE--------TTKLLIKGEGLDTDEQLPKLDTHTLQKILPDIDVTSF 815

  Fly   183 F-NYT---KQPGRSN-IGWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYR 242
            . |||   .:.|:|: ....||:         |.||...|||...|.|||.:.|. |..|..|.|
 Worm   816 VNNYTAFLSEDGQSSQEECSPKM---------LPCDHTTRYRTFNGWCNNLKFPE-YANSFAPLR 870

  Fly   243 RMVSPDYADGIAAPRV-SHHGR-LPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSL 305
            .::.|.|.||..|||. :..|| ||..|:||..:......:...||.|:..|||.:||::|.:.:
 Worm   871 HLLPPQYDDGFDAPRTRAKSGRPLPNPRRVSNLVCEDKDVSHVKFTHMVMQFGQLLDHELTHSPV 935

  Fly   306 TTSQEGESIDCCVAATREQHPE-----CYPVDILPDDPY----YKQYNISCMNFVRSAPAPTGRF 361
            ......|.::|    |:...||     |.|:.:..|||:    |......|:.|.||..... ..
 Worm   936 ARGPNDEILNC----TKCDSPEKISVHCMPIRVEKDDPFFPTNYPNGEPRCLPFARSLLGQL-NL 995

  Fly   362 GPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTDDGRQLLPISSNPADGCNRVQMT 426
            |.|.||||.||::|.|.:||:.:.....||.|..|.|.......|:.:|| ..|....| |..:.
 Worm   996 GYRNQLNQLTAYVDGSAIYGSTKCEAKNLRLFTRGLLNFTDFGHGQMMLP-QGNQEKDC-RSTLE 1058

  Fly   427 RLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHI 491
            :....||.:||:|.:....||.||..:.|.||.:|.||...||.|.|:.:::|||:|:.|:|.||
 Worm  1059 KRHMPCFVAGDERNSHQPGLTIMHTFFVREHNRIAMQLSALNPQWNDDTVFEEARRIVTAEMQHI 1123

  Fly   492 TYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLF---N 553
            |:.||||.::|.::..|:.|:|.|:....  .||...|.||:..||.|||||.|||:..:|   |
 Worm  1124 TFAEFLPKIIGLDLLNAQNLVPKKNGYFG--GYDNTCDASISQPFATAAFRFGHTLIRRMFPRMN 1186

  Fly   554 ISRDN-STPEAIELHKMLFNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDR 617
            .:..| |.|..:..|.....|.....:.|:|..||....||.|..||..:..|...||....|  
 Worm  1187 YNYKNMSEPVDLAQHFGHVGPLYEQEKGGMDSMLMGLLGTPSMAFDRHITDAVRNHLFMRRGE-- 1249

  Fly   618 VPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVD 682
             ...|:||:.|||.|.||||:..|...|..|.|.....|:::...:|...::.::.:|||..|||
 Worm  1250 -KTSGMDLIVLNILRARDHGVQPYNDLREFCGLRRAVKWDDLKGEMDQDNINILQSLYESVDDVD 1313

  Fly   683 VYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAII 747
            ::.|.:||.||.||:.|..:||::::||.|||..|..:||......|||..||.||.|..||:|.
 Worm  1314 LFPGLVSERPLRGALLGTTMSCIIAEQFGRLKKCDRFYYENDNSAAKFTPGQLNEIRKVKLASIF 1378

  Fly   748 CRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSEKQ 792
            |.||..:..::.:|.....:..|..|.|.|:.  ..:...|.|::
 Worm  1379 CSNSKYLKTIQPNVFDVTDELTNAQVPCTDIP--QVDLSLWRERK 1421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 199/552 (36%)
peroxinectin_like 364..750 CDD:188655 147/390 (38%)
T06D8.10NP_496407.1 An_peroxidase 160..668 CDD:281139
peroxinectin_like 308..665 CDD:188655
An_peroxidase 847..1382 CDD:281139 198/548 (36%)
peroxinectin_like 998..1381 CDD:188655 147/390 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.