DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and skpo-1

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_495768.1 Gene:skpo-1 WormBaseID:WBGene00009897 Length:655 Species:Caenorhabditis elegans

Alignment Length:613 Identity:190/614 (31%)
Similarity:291/614 (47%) Gaps:109/614 (18%)


  Fly   201 VLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADG----IAAPRVSHH 261
            |.||.::  .:| |:.:||...|.|||.|:| ..||:...:.|::...|.||    ::|.|.:. 
 Worm   129 VAPDCSI--NQC-FHKKYRSMDGTCNNLQNP-VKGAAFTAFTRLMPAAYDDGFNTLVSASRRNR- 188

  Fly   262 GRLPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHP 326
               |..|:||:.:..|......:...:|.:||||:.|||      ||...::...|    :...|
 Worm   189 ---PNPREVSVFLLSSERSLPGHVNSLLMLFGQFVSHDI------TSNAAQNFCGC----QNSGP 240

  Fly   327 ECYPVDILPDDPYYKQYNISCMNFVRSAP-APTGRFG-PRMQLNQATAFIDASVVYGNLEQRQNQ 389
            .|..:...|.|...:     |:.|.||.| ..||:|| .|.|||..||.||||::||:.......
 Worm   241 MCASIFAPPSDRSRR-----CIPFTRSFPICGTGQFGRVREQLNMNTAAIDASLIYGSEAITARS 300

  Fly   390 LR-------SFINGSLRMFVTDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLT 447
            ||       |.|.|  |||         |.::||..              ..:||.||...:.|.
 Worm   301 LRFAAMLRTSMIGG--RMF---------PPNTNPGS--------------LTAGDGRAILFVGLA 340

  Fly   448 SMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLL 512
            ::|..:.|.||.:|.:||..|.||..:|::||:|||:|..:..|||.||:|.|:|.         
 Worm   341 ALHTSFLRLHNNVAARLQNMNRHWNADRIFQESRKIVGGIVQVITYQEFVPELIGD--------- 396

  Fly   513 PAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKMLFNPFSLW 577
            .:|..|.|.:.|:|.|:..:.|.|||.|:|. |.::...:.:.  ||..:.:..::.:.      
 Worm   397 ASKTILGAYNGYNPNVEIGVLNEFAAGAYRL-HGMIQETYPLV--NSQFQEVNRYRFID------ 452

  Fly   578 AEHGIDHAL----------MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQR 632
            ..:.|:|.|          ||   .||....| .:..||::||.|:         :|:.::||||
 Worm   453 GVNNINHVLNNIDAIYRGMMT---VPVRSPQR-LTTSVTERLFGGS---------VDMAAVNIQR 504

  Fly   633 GRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAI 697
            |||||:.||..:||.|.|..:.::.:..:..|......|.|:|.:|.|:|.|.|.:.|.|..|::
 Worm   505 GRDHGLRSYNDYRRFCNLRPITSFNDWPEVPDENVRQRIGQLYRTPDDLDFYVGGILEQPAAGSL 569

  Fly   698 FGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVM 762
            .|...:|::..||.||:.||..:||   .|..||..||||:.:|:|:.::|:..|.:.||.....
 Worm   570 LGATFACVIGKQFERLRDGDRFYYE---NPGVFTSPQLAELKRTTLSWVLCQTGDNMVRVGRRAF 631

  Fly   763 QRLRDGGNPHVDCQDLEGFHFNFEPWSE 790
            .  .:.|:..|.|..:.|  .|.|.|.|
 Worm   632 D--IENGSRAVPCSSITG--LNLEAWRE 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 175/560 (31%)
peroxinectin_like 364..750 CDD:188655 129/403 (32%)
skpo-1NP_495768.1 ShKT 22..56 CDD:214586
An_peroxidase 143..623 CDD:281139 175/559 (31%)
peroxinectin_like 275..619 CDD:188655 129/403 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I1745
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.